SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A090N8Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A090N8Y2
Domain Number 1 Region: 172-285
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.34e-36
Family PDI-like 0.001
Further Details:      
 
Domain Number 2 Region: 490-636
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.4e-36
Family PDI-like 0.00075
Further Details:      
 
Domain Number 3 Region: 59-167
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.77e-35
Family PDI-like 0.0031
Further Details:      
 
Domain Number 4 Region: 287-395
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.01e-21
Family Calsequestrin 0.037
Further Details:      
 
Domain Number 5 Region: 402-524
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000254
Family PDI-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A090N8Y2
Sequence length 645
Comment (tr|A0A090N8Y2|A0A090N8Y2_HUMAN) Endoplasmic reticulum resident protein 72 {ECO:0000256|PIRNR:PIRNR036862} OX=9606 OS=Homo sapiens (Human). GN=tcag7.505 OC=Catarrhini; Hominidae; Homo.
Sequence
MRPRKAFLLLLLLGLVQLLAVAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKE
ENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKI
DATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTL
VLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAE
TDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFL
KDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQGQLVVMQP
EKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRYTRRPLVVVYYS
VDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILD
ESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVM
DPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGF
PTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKEEL
Download sequence
Identical sequences A0A090N8Y2 P13667
ENSP00000286091 NP_004902.1.87134 NP_004902.1.92137 ENSP00000286091 hsi002003420.1 gi|4758304|ref|NP_004902.1| 9606.ENSP00000286091 ENSP00000286091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]