SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091D1M3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091D1M3
Domain Number 1 Region: 197-365
Classification Level Classification E-value
Superfamily L domain-like 2.3e-37
Family Ngr ectodomain-like 0.062
Further Details:      
 
Domain Number 2 Region: 8-163
Classification Level Classification E-value
Superfamily L domain-like 5.55e-36
Family Ngr ectodomain-like 0.024
Further Details:      
 
Domain Number 3 Region: 500-613
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000915
Family Rhodopsin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091D1M3
Sequence length 733
Comment (tr|A0A091D1M3|A0A091D1M3_FUKDA) Leucine-rich repeat-containing G-protein coupled receptor 6 {ECO:0000313|EMBL:KFO24403.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_14211 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MVGCSGLTLFPLQSGRHRDLSMNNLTELQPGLFRHLRFLEELRLSGNHLSHIPGQAFSGL
YSLKILRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNR
ISHIPDFAFQNLTSLVVLHLHNNRIQHLGTHGFEGLRNLETLRARLLCGASLWQEKEQIQ
AQLSGILTFQPLAEKGFHNNNIKAIPEKAFMGNPLLQTISLNGATDIQEFPDLKGTTSLE
ILTLTRAGIQLLPPGMCQQLPRLRVLELSHNQIKELPSLHRCQKLEEIGLQHNRIWEIGA
DTFSQLSSLQALDLSWNSIRSIHPEAFSTLRSLVKLDLTDNQLSTLPLAGLGGLMHLKLK
GNPALSQAFSKESFPKLRILEVPYAYQCCAYGVCASFSKTSGQWQAEDVHLEEEEAPKKP
LGLLAGQAETHYDLDLDELQLEMEDSKPHLSVQCSPVPGPFKPCEHLFESWGIRLAVWAI
ALLSVLCNGLVLLTPAALGLAVALVLLNSFCFLVVAGAYIRLYCDLPRGDFEAVWDCAMV
KHVAWLIVADGLLYCPVAFLSFASMLSLFPVTPEALKSVLLVVLPLPACLNPLLYLLFNP
HFRDDLRRLCPWAGTPGPLAYAPASELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLE
TYGFPSVTLISYQQPVAPRLEGSHFAEPEGAQFGTPQPCPDGELLRRAEGASGGDPSVSG
VFRPSGSVFAPHL
Download sequence
Identical sequences A0A091D1M3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]