SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091DTP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091DTP0
Domain Number 1 Region: 314-542
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-59
Family DBL homology domain (DH-domain) 0.000000628
Further Details:      
 
Domain Number 2 Region: 5-151
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.24e-52
Family Regulator of G-protein signaling, RGS 0.000000175
Further Details:      
 
Domain Number 3 Region: 543-677
Classification Level Classification E-value
Superfamily PH domain-like 6.88e-39
Family Pleckstrin-homology domain (PH domain) 0.0000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091DTP0
Sequence length 830
Comment (tr|A0A091DTP0|A0A091DTP0_FUKDA) Rho guanine nucleotide exchange factor 1 {ECO:0000313|EMBL:KFO33630.1} KW=Complete proteome; Reference proteome OX=885580 OS=Fukomys damarensis (Damaraland mole rat) (Cryptomys damarensis). GN=H920_04976 OC=Hystricomorpha; Bathyergidae; Fukomys.
Sequence
MLCSLGPKEAKKAFVDFYHSFLDKTAVLRVPVPPSVAFELDRTRPDLLSEDIQRRFVQEV
VQFQQATVGRQLEDFRSKRLMGMTLWEQELSQLEAWVGRDRASYEARERHVAERLLSHLE
EMQHTISSDEDKSAAVVTAISLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPPKTK
KGLSSILDAARWNRGENQAPDFRHLKSEVDAEKPGPTDRKGGLGISSRDRNPGTPGPDTS
GVSLHPLSGDCPEREPGVDAPLELGDPPSQGPISLEPLVPPESTEEGAETESPEPGDEGE
PGRSGLELEPEEPPGWRELVPPDTLLSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLF
YQPIAEGGFFLLEELQNIFPSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARFDG
AEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCRRLQLKDMIPTEM
QRLTKYPLLLQSIGQNTEEPKEREKVEQAAECCRLILHHVNQAVRDTEDLLRLRDYQRRL
DLSHLRQSNDPMLSEFKNLDITKKKLVHEGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQD
ERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDHKAFYVIFTWDQEAQIYELVA
QTVSERKNWCALITETAGSLKVPAPASRPKPRPSPSSTREPLLSSSENGNGGREVPPADA
QTERILSDLLPFCRPGPEGQLAATALRKVLSLKQLLLPTEEDSGAGPPREGDGVPGGGPL
GPAQIQEIQENLLSLEEAVKQLEELEEEFCRLRPLLAQLGGNPVPQPGCT
Download sequence
Identical sequences A0A091DTP0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]