SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091G119 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091G119
Domain Number 1 Region: 15-267
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.12e-67
Family Ankyrin repeat 0.0000534
Further Details:      
 
Domain Number 2 Region: 244-342
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000359
Family Ankyrin repeat 0.0028
Further Details:      
 
Domain Number 3 Region: 454-501
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000942
Family SOCS box-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091G119
Sequence length 537
Comment (tr|A0A091G119|A0A091G119_9AVES) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:KFO76200.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_00732 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
MDFTEAYSDRCSVVGLAVREGNVKMLRKLIKQGYSIDVQDNRGWMPIHEAAAHNFSECLR
VLVNAASSDDYINSKTFDGLCALHLSARHGSLQSLRVLLEAGADPNQVTTEETTALFLAV
ENGHTDIVKFLIQHGANVKGPHSWSGWNSLHEASFQGYTEIMEILLEKGASKECKDNFGI
TPLFVSAQYGKLESLRLLVSHGAEVNCQAKDKATPLLIAAQEGHTECVELLLSKGADPNL
YCNNDNWQLPIHAAAQMGHKRILELLIPITDRICDKGEGKVSPVYSAVYGGNKECLEMLL
REGYSPDAQECLKFDCVSPMCMVFQKKLFSFIDIFLKYGITLLGINLGYCLFHEKFTLFQ
RFLKLGCLLPSGDQLLEFVRYTVKAHEEYKEWLPYLLLAGFNPVNLMHRFWIFSVSESAL
NFILEFTDWKRLPPHVQRDLSDYKEKFTWTPKSHFASIPSLSHLCRLEIRSVLTSEHLRS
DQFIRELPLPTYLQDYLLYLDVLRANSILGAEDYLGQREEGATSTSHSSAEDAERRD
Download sequence
Identical sequences A0A091G119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]