SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091GVX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091GVX4
Domain Number 1 Region: 512-881
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.22e-127
Family Hect, E3 ligase catalytic domain 0.0000000038
Further Details:      
 
Domain Number 2 Region: 6-141
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.83e-30
Family Synaptotagmin-like (S variant) 0.028
Further Details:      
 
Domain Number 3 Region: 459-497
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000131
Family WW domain 0.00013
Further Details:      
 
Domain Number 4 Region: 330-369
Classification Level Classification E-value
Superfamily WW domain 0.000000000000209
Family WW domain 0.0016
Further Details:      
 
Domain Number 5 Region: 172-213
Classification Level Classification E-value
Superfamily WW domain 0.0000000000012
Family WW domain 0.0013
Further Details:      
 
Domain Number 6 Region: 406-442
Classification Level Classification E-value
Superfamily WW domain 0.0000000000025
Family WW domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091GVX4
Sequence length 888
Comment (tr|A0A091GVX4|A0A091GVX4_9AVES) E3 ubiquitin-protein ligase NEDD4 {ECO:0000313|EMBL:KFO78252.1} KW=Complete proteome; Reference proteome OX=55661 OS=Cuculus canorus (common cuckoo). GN=N303_08859 OC=Coelurosauria; Aves; Neognathae; Cuculiformes; Cuculidae; Cuculus.
Sequence
QENTRIVRVKVISGIGLAKKDLLGASDPYVKVTVYDPADGVLTSVQTKTIRKSLNPKWNE
ELLFRVNPQKHRLLFEVFDENRLTRDDFLGQVDIPLYQLPTENPSMERPYTFKDFVLHPR
SHKSRVKGHLRLKMTYLPKSNGSEEETTEQAEELEPGWIILDQPDAASQPQQQQQGSPPL
PSGWEERQDILGRTYYVNHEFRRTQWKRPTAQDSVAVADIGSVQLEAQHVFTHRRQISED
TENLDSRDSPESWEIITEDEATMYSNQNLQIPLSLSNCDIQTHLAEELNTRLTTSGSSAT
GQSVAYTNHSSRRGSLQTYRVEEQPAHPVLLPTSSGLPPGWEERQDEKGRSYYIDHNSRT
TTWIKPMVQVAVETGQLSAAQSISMGRQPQATSSDSSQQSSHQQPEMEQGFLPKGWEVRH
APNGRPFFIDHNTKTTTWEDPRLKISAHLRRKTSLDPVDLGPLPPGWEERTHTDGRVFFI
NHNTKKTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRKKLKKQSDIPNRFEMKIHRTTI
LEDSYRRIIAVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSA
TDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDAFFIRPFYKMMLQKPITLH
DMESVDSEYYNSLRWILENDPTELDLRFIVDEELFGQTHQHELKNGGSEIVVTNKNKRDY
IHLVIQWRFVSRVQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVADWKLHT
KYKNGYNINHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTV
EQWGTPEKLPRAHTCFNRLDLPPYDSFEDLWDKLLLAIENTQGFDGVD
Download sequence
Identical sequences A0A091GVX4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]