SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091HS26 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HS26
Domain Number 1 Region: 13-268
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.58e-68
Family Ankyrin repeat 0.0000364
Further Details:      
 
Domain Number 2 Region: 244-364
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000323
Family Ankyrin repeat 0.009
Further Details:      
 
Domain Number 3 Region: 461-509
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000124
Family SOCS box-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091HS26
Sequence length 540
Comment (tr|A0A091HS26|A0A091HS26_BUCRH) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:KFO90103.1} KW=Complete proteome; Reference proteome OX=175836 OS=Buceros rhinoceros silvestris. GN=N320_01156 OC=Coelurosauria; Aves; Neognathae; Bucerotiformes; Bucerotidae; Buceros.
Sequence
MDFTEAYSDRCSAVGLAAREGNVKMLRKLMKQGYSIDVPDNRGWVPIHEAAAHDSSECLR
LLLRAAPSEEYINSRTFEGLGALHLSARRGSLESIRVLLEAGADPNEVTIEATTPLFLAV
ENGHADVVKFLLQHGANVEGPHCWSGWNSLHQASFQGYTEIMEVLLENGASKECKDDFGI
TPLFVAAQYGKLESLRLLISHGAEVNCQAKDRATPLLIAAQEGHTKCVKLLLSKGADPNL
YCNTENWQLPIHAAAQMGHEKILELLIPVTDRICDRGRGKVSPVYSAVYGGHEECLETLL
ENGYSPDAQECLDLNCRSPMCMVFQKEFFNFVDVFLKYGITLLGINLGYCLFYKKFTLFR
RFLKLGCSLPSGDQLLEFTSYVIKVQQDYVIKVQREYKEWLPYLLLAGFNPVNLMRRFWI
FAVSNNVLNLILEFTNWKRLPPAVEQNLSDYKEKLVWTPKSYFAFVPSLSHLCRLEIRSI
LTSNRLRSDRFIRELPLPACLQDYLLYLDVLRANVIPEAEDYLGQREEGAAPTSRSSDED
Download sequence
Identical sequences A0A091HS26

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]