SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091HXB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091HXB1
Domain Number 1 Region: 511-880
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.15e-128
Family Hect, E3 ligase catalytic domain 0.00000000357
Further Details:      
 
Domain Number 2 Region: 5-140
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.38e-29
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 3 Region: 456-496
Classification Level Classification E-value
Superfamily WW domain 0.00000000000000799
Family WW domain 0.00013
Further Details:      
 
Domain Number 4 Region: 329-368
Classification Level Classification E-value
Superfamily WW domain 0.000000000000167
Family WW domain 0.0017
Further Details:      
 
Domain Number 5 Region: 170-211
Classification Level Classification E-value
Superfamily WW domain 0.00000000000115
Family WW domain 0.0013
Further Details:      
 
Domain Number 6 Region: 405-441
Classification Level Classification E-value
Superfamily WW domain 0.0000000000115
Family WW domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091HXB1
Sequence length 887
Comment (tr|A0A091HXB1|A0A091HXB1_CALAN) E3 ubiquitin-protein ligase NEDD4 {ECO:0000313|EMBL:KFP00909.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_11944 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
ENTRIVRVKVIAGLGLAKKDILGASDPYVKVTVYDPVNGVLTSVQTKTIKKSLNPKWNEE
HLFRVNPQKHRLLFEVFDENRLTRDDFLGQVDIPLYQLPTENPSMERPYTFKDFVLHPRS
HKSRVKGHLRLKMTYLPKSNGSEEETTEQAEELEPGWIILDQPDAASQPQQQQQESPPLP
SGWEERQDILGRTYYVNHEFRRTQWKRPTAQDNVAVADLGSVQLEAQHVFTHRRQISEDT
ENLDNRDSPESWEIITEDEATMYSNQNLQIPLSQSNCDIQTQIAEELNTRLTTSGSSATG
QSAAYTNHSSRRGSLQTYRVEEQPAQPVLLPTSSGLPPGWEERQDEKGRSYYIDHNSRTT
TWIKPVVQVAVEAGQLSAAQSVPVGRQLQATSSDSAQQSSQQQPEMEQGFLPKGWEVRHA
PNGRPFFIDHNTKTTTWGDPRLKISAHPRRKTSLDPGDLGPLPPGWEERTHTDGRIFFIN
HNTKKTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRKKLKKQSDIPNRFEMKIHRTTIL
EDSYRRIIAVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSAT
DNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDAFFIRPFYKMMLQKPITLHD
MESVDSEYYNSLRWILENDPTELDLRFIVDEELFGQTHQHELKSGGSEIVVTNKNKRDYI
HLVIQWRFVSRVQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVADWKLHTK
YKNGYNINHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTVE
QWGTPEKLPRAHTCFNRLDLPPYDSFEDLRDKLLLAIENTQGFDGVD
Download sequence
Identical sequences A0A091HXB1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]