SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091I990 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091I990
Domain Number 1 Region: 3209-3376
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.67e-29
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 3382-3560
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.4e-25
Family Laminin G-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 2774-2983
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.53e-16
Family Laminin G-like module 0.009
Further Details:      
 
Domain Number 4 Region: 2981-3147
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000677
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 5 Region: 2578-2766
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000136
Family Laminin G-like module 0.023
Further Details:      
 
Domain Number 6 Region: 1769-1818
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 7 Region: 1816-1871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000446
Family Laminin-type module 0.003
Further Details:      
 
Domain Number 8 Region: 1288-1336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000446
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 9 Region: 1427-1475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1378-1429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 11 Region: 1710-1762
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000181
Family Laminin-type module 0.0062
Further Details:      
 
Domain Number 12 Region: 393-441
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000187
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 13 Region: 151-212
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000193
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 14 Region: 210-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 15 Region: 529-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 16 Region: 484-531
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 17 Region: 1917-1966
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000243
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 18 Region: 626-676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 19 Region: 280-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 20 Region: 1870-1914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Laminin-type module 0.0046
Further Details:      
 
Domain Number 21 Region: 346-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 22 Region: 2334-2510
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000282
Family FCH domain 0.02
Further Details:      
 
Domain Number 23 Region: 439-486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 24 Region: 592-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000753
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 25 Region: 1671-1712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family Laminin-type module 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091I990
Sequence length 3561
Comment (tr|A0A091I990|A0A091I990_CALAN) Laminin subunit alpha-5 {ECO:0000313|EMBL:KFP04048.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_15705 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
QLFHVAYVLIKFANSPRPDLWVLERSTDFGLTYEPWQYFASSKRDCIEKFGLQTVDRITK
DDHAICTTEYSRIVPLENGEIVVSLVNGRPGAMNFSFSPLLRNFTKATNIRLRFLQTNTL
LGHLMGKALRDPTVTRRYYYSIKDISIGGRCVCHGHADVCDAKDPNDPYRLQCDCQHNTC
GGSCERCCPGFNQFPWQPATSDSANECQPCNCNSHAYDCYYDPEVDRHKASKSREEKFEG
GGVCIDCQHHTTGINCERCIPGYYRSPDHPIDSPYVCYRCNCESDFTDGTCEDLTGRCYC
KPNYTGEHCDACAEGYLNFPHCYPIPAFAHNDTGEQVLPAGQIINCDCYAGGTEGNACRK
DPVVGMCMCKPNFQGTHCDQCAPGHYGPSCQPCQCSGPGQYDGSCDSETGQCLCRTGFEG
HMCDQCAPGYFSYPLCQLCGCSTVGTQPGGCDSAGRCFCRPEFAGPRCEQCSPGHHSYPH
CYACSCDSWGAVDNDCSPAGQCQCHPNFAGHTCNQCALGFYGYPSCTPCQCSREGSLHST
CDQDTGQCSCRPKVTGQRCDSCLQGAYGFPHCEEGSCNPAGLETADPSLSPGSCSCRAYV
EGPACDRCKPLYWNLTPENPYGCTSCKCETKGTTSGIAECRQGDGQCFCKPNICGQLCST
CKDGYFNMENANYFGCQGCRCDVGGALGPSCEERSGGCRCRQSTRGPTCTQPARDHYFPD
LHHLKFELEEGTTPGGRAVRFGYNPLEFEGFSWRGYAQMSSIQPKVVVTLNVTSPDLFRL
VFRYVSRGPASVEGRVSVLEEGKFNVCGNCTEQTKQVVFAPSTEPAFVTVPQNSFGEPFV
LNPNTWSLVVEAEGVLLDYLVLLPSSYYEAPILQLKVTEPCTYQPAPEQATQNCLLYKYL
SVDGFPAASGLDAVCRLDNRLPRVCPVEQLTPSHPQMATCSGSDVEVQLSLPVLHPGKYV
LVVEYANRNALQTVGIAVSSPHLAMQQGKFIFYPCVYSFLCRGIAIDSQSRMVTFEVTSE
ATIQFTSDLADFFLHKVYLIPAAQFTMEFIEPKVHCISVHGTFSSNSSSCVPSRFLKLSQ
SIILEGGQALPIAPDVPLAQAVHVALSGVPMEPAPRPPTAVDPAAELILLHLQQAAVVFN
TRIQSLGRYAFILHYYQPNHPTFPVEVFINGGRIWQGQTNAAFCPHGYGCRSLVVSEDQI
VLDVTDNDLTVVVRVPQGKQLWLDYILVVPEDSYSSQYLQEEPLDKSYDFISSCGINSFY
INPSVSSRFCRDSAISLSLFYNNGAQPCQCHEAGARGSQCEPFGGQCPCKPNVIGRDCSR
CATGYWGFPNCRPCDCGTRLCDEVTGQCICPPHTLKPECVVCEPQTFGCHPLIGCEDCNC
SRPGVQELTEPGCDLDSGQCRCKPNVIGRQCDLCAPGYYHYPNCQRCDCHRAGTEPSVCD
PVTGQCHCKENVEGPRCDQCRLGTFSLDASNPKGCTKCFCFGATDRCRSAEKHRAEFVDM
SGWLLLSSDRQEVPTTLSLREQLLHADLKNLPDAYQELYWVAPSSYLGDRVSSYGGHLRY
ELHSNPRRGDIFIPMESRPDVILKGNQMSIMFLEATYPSPGEAHEGQLQLVEGNFRHTET
HNPVSREELMMVLANLEQLQIRALFSPLSSSVSLRRVVLEMATDSATGIRASNVELCFCP
ANYEGDSCQECAPGYYRDTKGLFLGKCIPCHCNGHSDQCLPGSGICLNCQHNTEGDHCER
CKDGYMGSHSAAEPLQCVGCPCPLSVASNNFAIGCVHKGLNMQCLCKPGYAGPNCERCAP
GYYGNPMVIGSSCQPCDCSGNTDPNMLFSSCDSLTGTCTGCMHHTAGTRCELCSPGYYGD
AVVAKNCTQCNCSPCGTESCHPQTGQCFCKTGVTGQHCDHCQEGYYGFEGCSGCRRCDCD
IGAVGSSCHPQTGQCHCLPGVSGSRCHQCAPGYWGFSQSGCTKCECRGGSCDPRTGQCTC
SNGLTGKQCNICQRENEIPVASGADSMRCEVCDSCVLLLLEDLQNMEKSFPSIRGQLVNL
NASSIAWARLHGLNSTMMTIVNQLREYLRAVNKVRQRADELEDENVDLTQDLNALQHKMT
MTHREANRIEQHSRETHQRGEQLLLNAQSIQKGIADLVQQVARIGAANASTTSTEEFRQK
MAEVERMLREMKERSLGSQEELARNEQEEAQKLLHRVRSELHARWQSNQDLVNSIQDRLL
QHSSQLMDLRDALNEAVNKTRQTEDLNSLNRNNLEESQQKSRELQKQHALVQETLKMAKD
SLAQVSDFLQKMESAKEAYEKLAALLDGAKLPLTERVKKFSPASSKIPIVEQAEEHAQLL
DELARNLSSIIQGTNQDGFIQRAIDASNAYASIIEAVRKAERAAHDADEAASQALMSVIS
ENLGAISKELKRNSSYLEEAVRREQRKLNGAIKGTLQTAKDKLADLRLKKEQLLSQLQSV
QDMLGRDQEDTKEALQNAKAAAAEANETAARVEDTLSTMKKNLDEWKDQYGGLRNEDLNQ
AVQDARKSVSSLESTIPLLLEKLSNLENRRNKNATVSENIVRIRQLITQARNAASKVKVP
MKFNGSSGVQVRLPSNLQDLAAYTSLKFYIQNPEPRSRQRRQEGTEEGRFVLYLGSREAT
GDYLGIVLKDHKVHWVYKLGAEEPTSLSVDEDIEEQFATISINRILQYGHMSVIVERQTV
HETKGESVAKGEQGLLNLDPRNVVFYVGGYPSSFTPPPALRYPNYRGCLELDTLNEEVVS
LYNFQHTFQVDTTAEKPCARSKSTGDPWLTDGSYFDGTGYAEIKFESQYGTTKRFEQEIR
VVSYNGILFFLENQAGHGAECPSCLPQGQFLCLAIRDGKLVLYYDFSTGLEMAKPSSNSS
SLAVSSTTNKAIQIFLLKMNNKKRILVRLERLTIFMVEQENSLENAVSYYLGGVPPDVLP
PSLKPLFPTGGPIRGCMKGLKALGKYVDLKRMSTVGVSYGCTSDLLVARTVGVHGHGYLT
LALKDVPGLQNFYSGFGFQTNQHQGLLYLHTTQEGTCQVSLQRGQLTLNLLGTEVTTGNV
YADGRAHYVAFYSDARGVRLYVYDELQDPTAGAGSTRRQRRQEERPRFHLGGSPEPGDLS
NLTGCIGNVFVKRISEPQMVVDLQQNVENINITMSCPWAEQLQQLRLTPKKDRRKPKVLS
KPLSKDRRHDGEGLCNLHLQPQAAGGTFRFGGSPSSRWEFKEIPPSFGWRSHFSLEVKLN
SSSGLLFYVLGKRGTFMALFVSNARFVFLLDLGGRRLRIRSKEKFRDGQWHTVFFSRDQG
RAQLVIDGLRAQDAAVATTGLFVARTPLYIGGIPPGKAPAHIPAAAASSFDGCLRNPQLD
GKPLGPPSHTFGVTPCYEGALENGVFFSADGGAITLADAVTTEQDLEVTLEVRPRSASGL
IFHVSTRRSHHLLLYMEETKVTVRAHAGADEFSTSVTSPSLCDGQWHSIAVTKWKNIIQV
DVDAEGNYTMGPSQPPAPSTRATFYLGGLPETEQGSTASLSPPLPHYVGCVRNLVMNRSH
VDLSRTGTVRGSVGLQGCPVL
Download sequence
Identical sequences A0A091I990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]