SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091IC83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091IC83
Domain Number 1 Region: 2-128
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.27e-48
Family Regulator of G-protein signaling, RGS 0.00000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091IC83
Sequence length 129
Comment (tr|A0A091IC83|A0A091IC83_CALAN) Regulator of G-protein signaling 3 {ECO:0000313|EMBL:KFP05098.1} KW=Complete proteome; Reference proteome OX=9244 OS=Calypte anna (Anna's hummingbird) (Archilochus anna). GN=N300_08011 OC=Coelurosauria; Aves; Neognathae; Apodiformes; Trochilidae; Calypte.
Sequence
RPTPEEALKWGDSLEKLLLHKYGLAAFRAFLRTEFSEENLEFWLACEEFKKIKSQSKMVS
KAKKIFAEYIAIQSCKEVNLDSYTREHTKENLQNITRSCFDLAQKRIYGLMEKDSYPRFL
RSDLYLDII
Download sequence
Identical sequences A0A091IC83 A0A091MHB9 A0A091MZZ4 A0A091PVA5 A0A091Q6C8 A0A091T8V4 A0A094KD14 A0A094MJ02

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]