SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091K6J1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091K6J1
Domain Number 1 Region: 504-873
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.62e-127
Family Hect, E3 ligase catalytic domain 0.00000000376
Further Details:      
 
Domain Number 2 Region: 5-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.28e-29
Family Synaptotagmin-like (S variant) 0.037
Further Details:      
 
Domain Number 3 Region: 451-489
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000223
Family WW domain 0.00013
Further Details:      
 
Domain Number 4 Region: 321-363
Classification Level Classification E-value
Superfamily WW domain 0.000000000000113
Family WW domain 0.0017
Further Details:      
 
Domain Number 5 Region: 167-206
Classification Level Classification E-value
Superfamily WW domain 0.00000000000181
Family WW domain 0.0013
Further Details:      
 
Domain Number 6 Region: 398-434
Classification Level Classification E-value
Superfamily WW domain 0.00000000000292
Family WW domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091K6J1
Sequence length 880
Comment (tr|A0A091K6J1|A0A091K6J1_COLST) E3 ubiquitin-protein ligase NEDD4 {ECO:0000313|EMBL:KFP31758.1} KW=Complete proteome; Reference proteome OX=57412 OS=Colius striatus (Speckled mousebird). GN=N325_12165 OC=Coelurosauria; Aves; Neognathae; Coliiformes; Coliidae; Colius.
Sequence
ENTRIVRVKVIAGIGLAKKDILGASDPYVKVTVYDPVNGVLTSVQTKTIKKSINPKWNEE
LLFRVNPQKHRLLFEVFDENRLTRDDFLGQVDVPLYQLPTENPSMERPYTFKDFVLHPRS
HKSRVKGHLRLKMTYLPKSNGSEEESTEQAEELEPGWIILDQPDAASQPESPPLPSGWEE
RQDILGRTYYVNHEFRRTQWKRPTAQDNVAVADIGSVQLEAQHVFTHRRQISEDTEDNRD
SPESWEIITEDEATMYSNQNLQIPLSQSNCDIQTHLAEELNTRLTTSGSSTTGQSAAYTN
HSSRRGSLQTYRVEEQPAHPVLLPTTSGLPPGWEERQDEKGRSYYIDHNSRTTTWIKPVV
QMTMETGQLSGTQSIPIGRLPQATSSDSSQQSSQQQPEVEQGFLPKGWEVRHAPNGRPFF
IDHNTKTTTWEDPRLKISAHPRRKTSLDPVDLGPLPPGWEERTHTDGRIFFINHNTKKTQ
WEDPRLQNVAITGPAVPYSRDYKRKYEFFRKKLKKQSDIPNRFEMKIHRTTILEDSYRRI
IAVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQI
NPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDAFFIRPFYKMMLQKPITLHDMESVDSE
YYNSLRWILENDPTELDLRFIVDEELFGQTHQHELKSGGSEIVVTNKNKRDYIHLVIQWR
FVSRVQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVADWKLHTKYKNGYNI
NHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTVEQWGTPEK
LPRAHTCFNRLDLPPYDSFEDLWDKLLLAIENTQGFDGVD
Download sequence
Identical sequences A0A091K6J1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]