SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091L5R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091L5R0
Domain Number 1 Region: 119-247
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.88e-43
Family Regulator of G-protein signaling, RGS 0.0000243
Further Details:      
 
Domain Number 2 Region: 43-107
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 4.58e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091L5R0
Sequence length 284
Comment (tr|A0A091L5R0|A0A091L5R0_CATAU) Regulator of G-protein signaling 7 {ECO:0000313|EMBL:KFP50588.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_07042 OC=Cathartes.
Sequence
PGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSHSPTHTPVPETKPPTEDELHQEIK
HWQMQLDRHRLKMSKVAESLLAYTEQYLEYDPFLVPPDPSNPWISDDTTFWELEASKEPG
QQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENLRFWLAVEDLKKRPIREVPARVQE
IWQEFLAPGAPSAINLDSKSYDKTTQNVKDPGRYTFEDAQEHIYKLMKSDSYPRFIRSSA
YQELLQAKKKLENTLDRRTSFEKFTRNVGKSLTSKRLTSLVQSY
Download sequence
Identical sequences A0A091L5R0 A0A093EXM2 A0A093HRB2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]