SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091LAB5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091LAB5
Domain Number 1 Region: 603-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000021
Family EGF-type module 0.005
Further Details:      
 
Domain Number 2 Region: 412-541
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000282
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 705-831
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 4 Region: 637-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000298
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 5 Region: 348-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000586
Family EGF-type module 0.007
Further Details:      
 
Domain Number 6 Region: 312-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000088
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 7 Region: 271-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000783
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 682-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000115
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091LAB5
Sequence length 1193
Comment (tr|A0A091LAB5|A0A091LAB5_CATAU) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_02466 OC=Cathartes.
Sequence
QVTLASGQFELEILSMQNVNGELQNGNCCDGTRNPGDRKCTRDECDTYFKVCLKEYQSRV
TAGGPCSFGSKSTPVIGGNTFNLKYNRNNEKNRIVIPFSFAWPRSYTLLVEAWDYNDNST
NPDRIIEKASHSGMINPSRQWQTLKHNAGVAHFEYQIRVTCAEHYYGFGCNKFCRPRDDF
FTHHTCDQNGNKTCLEGWMGPECNKAICRQGCSPKHGSCTIPGECRCQYGWQGQYCDKCI
PHPGCVHGTCIEPWQCLCETNWGGQLCDKDLNYCGTHPPCLNGGTCSNTGPDKYQCSCPE
GYSGQNCEIAEHACLSDPCHNGGSCLETSTGFECVCAPGWAGPTCTDNIDDCSPNPCGHG
GTCQDLVDGFKCICPPQWTGKTCQLDANECEGKPCVNANSCRNLIGSYYCDCFPGWSGHN
CDININDCRGQCQNGGSCRDLVNGYRCICSPGYAGDHCEKDINECASNPCMNGGHCQDEI
NGFQCLCPAGFSGNLCQLDIDYCEPNPCQNGAQCFNLAMDYFCNCPEDYEGKNCSHLKDH
CRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCGPHGKCKSQAGGKFTCECNKGFTGTYC
HENINDCESNPCKNGGTCIDGINSYKCICSDGWEGTYCETNINDCSKNPCHNGGTCRDLV
NDFFCECKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDTFKCMCPAGWEGATCNIARNS
SCLPNPCHNGGTCVVSGDSFTCVCKEGWEGPTCTQNTNDCSPHPCYNSGSCVDGDNWYRC
ECAPGFAGPDCRININECQSSPCAFGATCVDEINGYRCICPPGRSGPGCQEVTGRPCITS
VRVMPDGAKWDDDCNTCQCLNGKVTCSKVWCGPRPCVIHAKGHNECPAGHACVPVKEDHC
FTHPCAAVGECWPSNQQPVKTKCNSDSYYQDNCANITFTFNKEMMAPGLTTEHICSELRN
LNILKNVSVDYSIYITCEPSHLANNEIHVAISAEDIGEDENPIKDITDKIIDLVSKRDGN
NTLIAAVAEVRVQRRPVKNKTDFLVPLLSSVLTVAWICCLVTVFYWCIRKRRKQSSHTHT
ASDDNTTNNVREQLNQIKNPIEKHGANTVPIKDYENKNSKIAKIRTHNSEVEEDDMDKHQ
QKARFAKQPAYTLVDRDEKPPNSTPTKHPNWTNKQDNRDLESAQSLNRMEYIV
Download sequence
Identical sequences A0A091LAB5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]