SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091LPI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091LPI2
Domain Number 1 Region: 518-887
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.75e-127
Family Hect, E3 ligase catalytic domain 0.00000000376
Further Details:      
 
Domain Number 2 Region: 5-137
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-29
Family Synaptotagmin-like (S variant) 0.034
Further Details:      
 
Domain Number 3 Region: 465-503
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000236
Family WW domain 0.00013
Further Details:      
 
Domain Number 4 Region: 336-376
Classification Level Classification E-value
Superfamily WW domain 0.000000000000153
Family WW domain 0.0017
Further Details:      
 
Domain Number 5 Region: 178-218
Classification Level Classification E-value
Superfamily WW domain 0.00000000000153
Family WW domain 0.0013
Further Details:      
 
Domain Number 6 Region: 412-448
Classification Level Classification E-value
Superfamily WW domain 0.00000000000236
Family WW domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091LPI2
Sequence length 894
Comment (tr|A0A091LPI2|A0A091LPI2_CARIC) E3 ubiquitin-protein ligase NEDD4 {ECO:0000313|EMBL:KFP61383.1} KW=Complete proteome; Reference proteome OX=54380 OS=Cariama cristata (Red-legged seriema). GN=N322_11787 OC=Coelurosauria; Aves; Neognathae; Cariamiformes; Cariamidae; Cariama.
Sequence
ENTRIVRVKVIAGIGLAKKDLLGASDPYVKVTVYDPVNGVLTSVQTKTIKKSLNPKWNEE
LLFRVNPQKHRLLFEVFDENRLTRDDFLGQVDVPLYQLPTENPSMERPYTFKDFVLHPRS
HKSRVKGHLRLKMTYLPKSNGSEEETTEQAEELEPGWIILDQPDAASQPQQQAPQPQQQQ
QEAPPLPSGWEERQDILGRTYYVNHEFRRTQWKRPTAQDNVAVADIGSVQLEAQHVFTHR
RQISEDTENIDNRDSPESWEIITEDEATMYSNQNLQIPLSQSNCDIQTHLAEELNTRLTT
SGSSATGQPAAYTNHSSRRGSLQTYRVEEQPAHPVLLPTSSGLPPGWEERQDEKGRSYYI
DHNSRTTTWIKPVVQIAMETGQLSAAQSISMGRQPQATSSDSSQQSSQQQPEMEQGFLPK
GWEVRHAPNGRPFFIDHNTKTTTWEDPRLKISAHPRRKTSLDPVDLGPLPPGWEERTHTD
GRIFFINHNTKKTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRKKLKKQSDIPNRFEMK
IHRTTILEDSYRRIIAVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLLSKEMFNPYYG
LFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDAFFIRPFYKMMLQ
KPITLHDMESVDSEYYNSLRWILENDPTELDLRFIVDEELFGQTHQHELKSGGSEIVVTN
KNKRDYIHLVIQWRFVSRVQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVA
DWKLHTKYKNGYNINHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNG
PQLFTVEQWGTPEKLPRAHTCFNRLDLPPYDSFEDLWDKLLLAIENTQGFDGVD
Download sequence
Identical sequences A0A091LPI2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]