SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MA12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MA12
Domain Number 1 Region: 263-318
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000115
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091MA12
Sequence length 319
Comment (tr|A0A091MA12|A0A091MA12_CATAU) Spondin-2 {ECO:0000313|EMBL:KFP55517.1} KW=Complete proteome; Reference proteome OX=43455 OS=Cathartes aura (Turkey vulture) (Vultur aura). GN=N323_03040 OC=Cathartes.
Sequence
KVIWTLLVTILGYASSLPVGDDSICTAEELAKYSIIFTGKWSQTAFPKQYPLYRPPAQWS
SMLGVTHSSDYSMWKKNEYASNGVRDFAEKGEAWVLMKEIEEAGEKIQSVHGIFSAPAIS
SGTGQTSTELEAHSRHPLVSFVVRIVPSPDWFVGIDSLNLCEGDRWMEEISIDLFPYDAG
TDSGFTFSSPNFATIPQDTVTEITCSSPSHPANSFYYPKLKILPPIAQVTMVKLKKNQLG
LLVPYLNLPAKSNEIIDSVSETPLDCEVSQWSSWGLCRGLCRKTGTKIRTRFVVLQPANN
GMPCPNLDEETACEPENCV
Download sequence
Identical sequences A0A091MA12

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]