SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MI72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MI72
Domain Number 1 Region: 603-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000377
Family EGF-type module 0.005
Further Details:      
 
Domain Number 2 Region: 412-541
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000957
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 705-831
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000651
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 4 Region: 348-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000159
Family EGF-type module 0.007
Further Details:      
 
Domain Number 5 Region: 637-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000305
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 6 Region: 312-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000266
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 7 Region: 271-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000877
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 682-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091MI72
Sequence length 1193
Comment (tr|A0A091MI72|A0A091MI72_9PASS) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_02520 OC=Acanthisitta.
Sequence
QVTLASGQFELEILSMQNVNGELQNGNCCDGTRNPGDKKCTRDECDTYFKVCLKEYQSRV
TAGGPCSFGSKSTPVIGGNTFNLKYNRNNEKNRIVIPFSFAWPRSYTLLVEAWDYNDNST
NPDHIIEKASHSGMINPSRQWQTLKHNAGVAQFEYQIRVTCAEHYYGFGCNKFCRPRDDF
FTHHTCDQNGNKTCLEGWMGPECNKAICRQGCSPKHGSCTIPGECRCQYGWQGQYCDKCI
PHPGCVHGTCTEPWQCLCETNWGGQLCDKDLNYCGTHPPCLNGGTCSNTGPDKYQCSCPE
GYSGQNCEIAEHACLSDPCHNGGSCLETLTGFECVCAPGWAGPTCTDNIDDCSPNPCGHG
GTCQDLVDGFKCICPPQWTGKTCQLDANECEGKPCVNANSCRNLIGSYYCDCITGWSGHN
CDININDCRGQCQNGGSCQDLVNGYRCICSPGYAGDHCEKDINECASNPCMNGGHCQDEI
NGFQCLCPAGFSGNLCQLDIDYCEPNPCQNGAQCFNLAMDYFCNCPEDYEGKNCSHLKDH
CRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCGPHGKCKSQAGGKFTCECNKGFTGTYC
HENINDCESNPCKNGGTCIDGINSYKCICSDGWEGTYCETNINDCSKNPCHNGGTCRDLV
NDFFCECKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDTFKCMCPAGWEGATCNIARNS
SCLPNPCHNGGTCVVSGDSFTCVCKEGWEGPTCTQNTNDCSPHPCYNSGTCVDGENWYRC
ECAPGFAGPDCRININECQSSPCAFGATCVDEINGYRCICPPGRSGPGCQEVTGRPCITS
VRVMPHEAKWDDDCNTCQCQNGKVTCSKIWCGPRPCVLHGKGHTECPVGHTCVPVREDHC
FTHPCAAVGECWPSNQQPVRTKCNSDSYYQDNCANITFTFNKDMMATGLTTEHVCSELRN
LNILKNVSVEYSIYITCEPSHLANNEIHVAISAEDTGEDENPIKGITDKIIDLVSKRDGN
NTLIAAVAEVRVQRRPVKSRTDFLVPLLSSVLTVAWICCLVTVFYWCIRKRRKQSSHTHT
ASDDNTTNNVREQLNQIKNPIEKHGANTVPIKDYENKNSKIAKIRTHNSEVEEDDMDKHQ
QKARFAKQPAYTLVDRDEKPPNSTPTKHPNWTNKQDNRDLESAQSLNRMEYIV
Download sequence
Identical sequences A0A091MI72

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]