SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091MNZ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091MNZ6
Domain Number 1 Region: 513-881
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.83e-127
Family Hect, E3 ligase catalytic domain 0.0000000038
Further Details:      
 
Domain Number 2 Region: 6-143
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.99e-29
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 3 Region: 459-497
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000236
Family WW domain 0.00014
Further Details:      
 
Domain Number 4 Region: 330-369
Classification Level Classification E-value
Superfamily WW domain 0.000000000000181
Family WW domain 0.0017
Further Details:      
 
Domain Number 5 Region: 171-212
Classification Level Classification E-value
Superfamily WW domain 0.000000000000932
Family WW domain 0.0013
Further Details:      
 
Domain Number 6 Region: 406-442
Classification Level Classification E-value
Superfamily WW domain 0.00000000000236
Family WW domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091MNZ6
Sequence length 888
Comment (tr|A0A091MNZ6|A0A091MNZ6_9PASS) E3 ubiquitin-protein ligase NEDD4 {ECO:0000313|EMBL:KFP78403.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_03844 OC=Acanthisitta.
Sequence
KENTRIVRVKVIAGIGLAKKDILGASDPYVKVTVYDPVNGILTSVQTKTIKKSLNPKWNE
ELLFRVNPQKHRLLFEVFDENRLTRDDFLGQVDIPLYQLPTENPSMERPYTFKDFVLLPR
SHKSRVKGHLRLKMTYLPKNNGSEEETTEQAEELEPGWIILDQPDAASQPQQQQQEPPPL
PAGWEERQDILGRTYYVNHEFRRTQWKRPTAQDNAAVADMGNVQLEAQHVFTHRRQISED
TENVDNRDSPESWEIITEDEATMYSSQNLPIPLSQSNSDIQTNLAEELSNRLTTSGSSAT
GQTAAYTNHSSRRGSLQTYRGEEQPAHPVLLPTSSGLPPGWEERQDDKGRSYYIDHNSRT
TTWIKPVVQTAVETSQVAAAQGVSTGRQPQATSSDASQQSSQQQPEMEQGFLPKGWEVRH
APNGRPFFIDHNTKTTTWEDPRLKISAHPRRKTSLDPVDLGPLPPGWEERTHTDGRIFFI
NHNTKRTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRKKLKKQGDIPNRFEMKIHRTTI
LEDSYRRIIAVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSA
TDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDAFFIRPFYKMMLQKPITLH
DMESVDSEYYNSLRWILENDPTELDLRFIVDEELFGQTHQHELKSGGSEIVVTNKNKRDY
IHLVIQWRFVSRVQKQMTAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVADWKLHT
KYKNGYNINHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTV
EQWGTPEKLPRAHTCFNRLDLPPYDSFEDLWDKLLIAIENTQGFDGVD
Download sequence
Identical sequences A0A091MNZ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]