SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091NDV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091NDV0
Domain Number 1 Region: 3406-3582
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.86e-26
Family Laminin G-like module 0.002
Further Details:      
 
Domain Number 2 Region: 3237-3398
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-21
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 3022-3186
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.82e-18
Family Laminin G-like module 0.037
Further Details:      
 
Domain Number 4 Region: 2814-3016
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.2e-16
Family Laminin G-like module 0.0093
Further Details:      
 
Domain Number 5 Region: 2620-2805
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000165
Family Laminin G-like module 0.053
Further Details:      
 
Domain Number 6 Region: 1817-1866
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000113
Family Laminin-type module 0.083
Further Details:      
 
Domain Number 7 Region: 1864-1919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family Laminin-type module 0.0033
Further Details:      
 
Domain Number 8 Region: 202-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000113
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 9 Region: 1475-1523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family Laminin-type module 0.0096
Further Details:      
 
Domain Number 10 Region: 1336-1384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 11 Region: 444-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 12 Region: 1758-1810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000239
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 13 Region: 1426-1477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000273
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 14 Region: 261-320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 15 Region: 580-628
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 16 Region: 677-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family Laminin-type module 0.0064
Further Details:      
 
Domain Number 17 Region: 535-582
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 18 Region: 1918-1962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000268
Family Laminin-type module 0.004
Further Details:      
 
Domain Number 19 Region: 331-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 20 Region: 627-674
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000781
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 21 Region: 1965-2014
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000949
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 22 Region: 397-440
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 23 Region: 490-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 24 Region: 1718-1760
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000725
Family Laminin-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091NDV0
Sequence length 3583
Comment (tr|A0A091NDV0|A0A091NDV0_9PASS) Laminin subunit alpha-5 {ECO:0000313|EMBL:KFP75809.1} KW=Complete proteome; Reference proteome OX=57068 OS=Acanthisitta chloris (rifleman). GN=N310_06145 OC=Acanthisitta.
Sequence
QGQYCDICSSANSNKAHPITNAIDGTERWWQSPPLSRGLEFNQVNVTLDLGQLFHVAYVL
IKFANSPRPDLWVLERSTDFGLTYEPWQYFASSKRDCIEKFGQHTVDRITRDDHAICTTE
YSRIVPLENGEIVVSLVNGRPGAMNFSYSPLLRNFTKATNIRLRFLQTNTLLGHLMGKAL
RDPTVTRRYYYSIKDISIGGRCVCHGHADVCDAKDPNDPYRLQCDCQHNTCGGSCDRCCP
GYNQFPWKPATADSANECQPCNCNGHAYDCYYDPEVDRHKASKSREDKFEGGGVCIDCQH
HTTGINCERCIPGYYRSPDHPIDSPYICYRCNCESDFTDGTCEDLTGRCYCKPNYTGEHC
DACAEGYLNFPHCYPVPAFAHNDTGEQVLPAGQIINCDCYAGGTEGNACRIDPRVGMCVC
KPNFQGTQCDQCAPGHYGPSCQPCQCSGPGQYDGTCDSETGQCLCRTGFEGHLCNQCAPG
YFNYPLCQLCGCSAVGTLPGGCDSGGNCFCRPEFAGPRCEQCSPGYHSYPHCYACSCDPR
GAVDNNCSPAGQCRCHVNFAGHTCNQCALGFYGYPSCTPCQCSQEGSLHSTCDQDTGQCS
CRPKVTGQRCDSCVPGAYGFPHCEVGSCNPAGLETADPSLVPGSCACRAYVEGPACDRCK
PGYWNLTPENPYGCLSCKCDTKGTISRIAECRQRDGQCFCKPNVCGQFCSTCRDGYFNME
NANYFGCQGCRCDVGGSLGPSCDERSGACRCRQSTRGPTCTQPARDHYFPDLHHLKFELE
EGTTPSGRAVRFGYNPLEFEGFSWRGYAQMSSIQPKVVVTLNVTSPDLFRLDASRGPASV
EGRVSVVEEGKFNVCGNCTEQTKQIVFAPSTEPAFVTVPQNSFGEPFVLNPNTWSLVVEA
EGVLLDYLVLLPSSYYEAPILQLKVTEPCTYQPAPEQASQNCLLYKYLSVDGFPAVSGVD
AMCRLDNRLPRLCPTEQLTPSHPRMATCSGSDVEVQLSLPVAQPGKYVLVVEYANTNALQ
TVGIAVSSPHLAMQQGTFTFYPCVYSFLCRGIAVDSQSRMATFELTSEATVRFTSDLADF
FLHKVYLIHAAQFTMELIEPKVHCISVHGTFSSNSSSCVPSRFLKLSQSIILEGAQVLPI
APDVPLAQAVHVAPSGVPVEPAPRPPTAMDPTAELILLQSPQAAVVFNSRIQTLGRYAFI
LHYYQPNHPTFPVEVLINGGRIWQGQTNVNFCPHGYGCRSLVVSEDQIILDVTDNDLTVV
VRVPEGKQLWLDYILVVPEDSYSSQYLQEEPLDKSYDFISSCGVNSFYINPSTSSRFCRD
SAVSLSLFYNNGAQPCQCHEAGARGSQCEPFGGQCPCKSNVIGRECSRCATGYWGFPNCR
PCDCGTRLCDEVTGQCICPPHTLKPECVVCEPQTFGCHPLIGCEDCNCSRSGVQELTEPG
CDVNSGQCRCKPNIIGRQCDLCAPGYYHYPDCRRCECHQAGTEASVCDPVTGQCHCKENV
EGPRCDQCRLGTFSLDATNPKGCTKCFCFGATDRCRSAEKHRAEFVDMNGWVLLSSDRHE
VPTTLSLREQMVTGDLKNLLDAYQELYWVAPSSYLGDQVSSYGGHLRYELHSNPRRGDVF
IPMESRPDVILKGNQMSIMFLEGTYPSPGEIHQGQLQLVEGNFRHTETHNPVSREELMMV
LANLEQLQIRALFSQLSSSVSLRHVVLEKATDTATGIRASNVELCFCPANYQGDSCQECA
PGYYRDTKGLFLGKCIPCHCNGHSDQCLPGSGICLNCQHNTEGDHCERCKDGYTGSSSVE
EPLQCVGCPCPLSVASNNFAIGCVHKGSNMQCLCKPGYAGPHCERCAPGYYGNPMVIGSS
CQPCDCSGNTDPNMLFSSCDSLTGTCSGCMHHTAGARCEVCAPGYYGDAVVAKNCTQCNC
SPCGTDSCHPQTGQCYCKTGVTGQHCDRCEEGYYGFEGCSGCRRCDCDVGAVETSCHVQS
GQCNCLPGVSGSRCQQCAPGYWGFSQRGCTKCECRGGSCDPRTGECTCSNGLTGKQCDVC
MHKYEIPVANGPDNIKCEVCDSCVLLLLEDLQSMEMSFPSIRNQLVNLNASSIAWARLHG
LNSTMAAIANQLREYHRAMNKFRQRADELEDDNVDLTQDLNALQHKMTMTHREVIRVEQH
TRQTYQSGEQLLLHIQSIQRAIQDLVRQMVRFGAANTSTTSTEEFRQKMFEVETMLREMK
ERNLGSQEELARREHEEAQKLLHRVKSELHARWQANQDLVSSIQDRLAQHNSQLMDLRDA
LNEAVNKTRQTEDLNSLNRNNLEENQQKSQELQKQHALVQETLQMAKNALAQVSDFLQKM
ERAKEAYEKLAALLDGAKLPLTERVKKFSPASSKIPIVEQAEEHARLLDELAKNLSSIIQ
GTNQDGFIQRAIDASNAYASIIEAVKKAERAAHDADEAASKALMNVISENLEATSKVLRR
NSSSLEESVRREQTKLDGAIKGTLQTAKDKLADLRVRKEQLLNQLQSVKDMLGRDQGHNP
NSAPAKANETAARVEDTLSSMKKNLDEWKDQYGDIRNEDLNQAVQDARKSVSSLESTMPL
LLEKLSGLENRRNKNATVSENIVRIRQLITQARNAASKVKVPMKFNGSSGVQVRMPSNLQ
DLAAYTSLKFYIQNPEPRGRQDEAEEGRFVLYLGSREATGDYLGIVLKDRRVQCIYKLGD
EEPTSLSVDEDIGEQFATVSINRILQYGHMSVIVERQTVHEIKGDSVAKGEQGLLNLDPR
NVVFYMGGYPSSFTPPPTLRYPNYRGCLELDTLNEEVVSLYNFQHTFQLDTTAEKPCARS
KSTGDPWLTDGSYFDGTGYAEIKFESQFGPTKRFEQEIRVVSYNGIIFFLENQAVSVLPP
QGQFLCLAIRDGKLVLYYDFSSGLEMAKPSNTSSLTISSTTNKAIQIFLLKMNNKKRILV
RLERLTIFVVEQENSLENAVSYYLGGVPPAVLPTSLKAIFPTGGPIRGCMKGLKALGKYV
DLKRMNTVGVSYGCTSDLLIARSVSVHGHGYLTLALKDVPGLRDFYSGFSFQTSQRDGLL
YHHSTQEGTCQVSLQRGQLALNLLGTEVTTDNAYADNRAHYVAFYSDTRGVRLYVDDKLQ
DTTAGPGPSRRHARLLFQLGGSPDPSALSNLTGCIGNVFVKRTSEPQMVVDLQQNVETVN
VTMSCPWVEQPQQLRATTKKDRRKPKVPGKPAPKGRRHDQDGLCQLHPQPRAARGAFRFG
GAPSSRWEFDKIPDSFGHRSYFSLEVKLNSSSGLLFYVAGERGSFMALFVFNGRFVFLVD
IGGRRLRIRSKDKYRDRRWHTTRAQLVIDGLRAQDAAVATKGLFVARTPLYVGGIVAGKT
KVHIPAASASSFDGCLRNPQLDGRPLGPPSRTFGVTPCYEGALESGVFFAAGGGSITLAE
AVVTEQDLEVTLEVRPRSASGLIFHVGTRRSHHLLLYMEETKVTVRANAGADEFSASVTC
PSLCDGQWHSIAVTKWKNIIQIDVDTEGNHTVGPNQPPAPSTRATFSVGGLPETDKASTG
PLVPPLPHYVGCIRNLLINRRHMDLPRAGTARGSVGLRGCPVL
Download sequence
Identical sequences A0A091NDV0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]