SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091NZX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091NZX1
Domain Number 1 Region: 16-82
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000534
Family Growth factor receptor domain 0.0046
Further Details:      
 
Domain Number 2 Region: 173-217
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000068
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 79-124
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000022
Family Fibronectin type I module 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A091NZX1
Sequence length 316
Comment (tr|A0A091NZX1|A0A091NZX1_HALAL) WNT1-inducible-signaling pathway protein 3 {ECO:0000313|EMBL:KFP99328.1} KW=Complete proteome; Reference proteome OX=8969 OS=Haliaeetus albicilla (White-tailed sea-eagle). GN=N329_13218 OC=Accipitrinae; Haliaeetus.
Sequence
PSETGEVHQRKEVCHWPCRCPPVPTCTPGVSLVKDGCGCCKVCAKQSGETCNEADICDPH
KGLYCDYSEDEPRYETGVCAYLVAVGCELNGVYYLNGQTFQPNPLYKCLCVSGAIGCTPV
FTPRLAASPCTRVTGRRKPGQSICGPGQHKQLQSTNYRLMSAYRSLPLVLKKKCLVQATP
WTPCSRTCGIGISSRVTNENRKCEMKKEKRLCFIQPCLTNILKTIKIPKGKTCQPTFQLP
TAEKLFFSGCSTTQSYRLTFCGVCLDKRCCIPNKSKMITVQFECPNEGFFKWKMMWITSC
VCQRICTAPGDIFSEL
Download sequence
Identical sequences A0A091NZX1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]