SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091P1S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091P1S4
Domain Number 1 Region: 40-170
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.24e-48
Family Regulator of G-protein signaling, RGS 0.00000452
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091P1S4
Sequence length 170
Comment (tr|A0A091P1S4|A0A091P1S4_HALAL) Regulator of G-protein signaling 8 {ECO:0000313|EMBL:KFQ00316.1} KW=Complete proteome; Reference proteome OX=8969 OS=Haliaeetus albicilla (White-tailed sea-eagle). GN=N329_06415 OC=Accipitrinae; Haliaeetus.
Sequence
LPHIDHRNRGMRTRLGCLSHKSDSYNDFTAILPDKPNRALKRLSTEEATRWADSFDVLLS
HKYGLAAFRAFLKTEFSEENLEFWLACEDFKKTRSAAKLASKAQRIFEEFIDVQAPREVN
IDFQTRELTRRNMQEPSLSCFDQAQGKVHSLMEKDSYPRFLRSKIYTDLL
Download sequence
Identical sequences A0A087QVK4 A0A091L197 A0A091LTU5 A0A091NSU2 A0A091P1S4 A0A091PFD9 A0A091QDX5 A0A091SK76 A0A091TUE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]