SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091PK98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091PK98
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.03e-44
Family BAR domain 0.00000206
Further Details:      
 
Domain Number 2 Region: 178-253
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-25
Family SH3-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091PK98
Sequence length 257
Comment (tr|A0A091PK98|A0A091PK98_LEPDC) Endophilin-A2 {ECO:0000313|EMBL:KFQ07658.1} KW=Complete proteome; Reference proteome OX=188344 OS=Leptosomus discolor (Madagascar cuckoo roller) (Cuculus discolor). GN=N330_06419 OC=Leptosomus.
Sequence
GDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDY
KKKRQGKIPDEELRQAMEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAV
QILDELAEKLKRRMREASSRPKREYKPKPRETYDFGDTDQSNGGFSCNPTPKVSGAAGPA
HLSSPSPTPLPAAPLDQPCCKALYDFEPENDGELGFKEGDIITLTNQIDENWYEGMINGQ
SGFFPLNYVEVLVPLPQ
Download sequence
Identical sequences A0A091PK98

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]