SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091PV59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091PV59
Domain Number 1 Region: 603-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000293
Family EGF-type module 0.005
Further Details:      
 
Domain Number 2 Region: 412-541
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000105
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 705-831
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000534
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 4 Region: 348-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000782
Family EGF-type module 0.007
Further Details:      
 
Domain Number 5 Region: 637-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000224
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 6 Region: 312-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000429
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 7 Region: 272-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000877
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 682-716
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000088
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091PV59
Sequence length 947
Comment (tr|A0A091PV59|A0A091PV59_HALAL) Delta-like protein {ECO:0000256|RuleBase:RU280815} KW=Complete proteome; Reference proteome OX=8969 OS=Haliaeetus albicilla (White-tailed sea-eagle). GN=N329_05515 OC=Accipitrinae; Haliaeetus.
Sequence
QVTLASGQFELEILSMQNVNGELQNGNCCDGTRNPGDKKCTRDECDTYFKVCLKEYQSRV
TAGGPCSFGSKSTPVIGGNTFNLKYNRNNEKNRIVIPFSFAWPRSYTLLVEAWDYNDNST
NPDRIIEKASHSGMINPSRQWQTLKHNAGVAHFEYQIRVTCAEHYYGFGCNKFCRPRDDF
FTHHTCDQNGNKTCLEGWMGPECNKAICRQGCSPKHGSCTVPGECRCQYGWQGQYCDKCI
PHPGCVHGTCIEPWQCLCETNWGGQLCDKDLNYCGTHPPCLNGGTCSNTGPDKYQCSCPE
GYSGQNCEIAEHACLSDPCHNGGSCLETSTGFECVCAPGWAGPTCTDNIDDCSPNPCGHG
GTCQDLVDGFKCICPPQWTGKTCQLDANECEGKPCVNANSCRNLIGSYYCDCITGWSGHN
CDININDCRGQCQNGGSCRDLVNGYRCICSPGYAGDHCEKDINECASNPCMNGGHCQDEI
NGFQCLCPAGFSGNLCQLDIDYCEPNPCQNGAQCFNLAMDYFCNCPEDYEGKNCSHLKDH
CRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCGPHGKCKSQAGGKFTCECNKGFTGTYC
HENINDCESNPCKNGGTCIDGINSYKCICSDGWEGTYCETNINDCSKNPCHNGGTCRDLV
NDFFCECKNGWKGKTCHSRDSQCDEATCNNGGTCYDEGDTFKCMCPAGWEGATCNIARNS
SCLPNPCHNGGTCVVSGDSFTCVCKEGWEGPTCSQNTNDCSPHPCYNSGTCVDGDNWYRC
ECAPGFAGPDCRININECQSSPCAFGATCVDEINGYRCLCPPGRSGPGCQEVTGRPCITT
VRVMPDGAKWDDDCNTCQCLNGKVTCSKVWCGPRPCVIHAKGHNECPAGHACVPVKDDHC
FTHPCAAVGECWPSNQQPVKTKCNSESYYQDNCANITFTFNKEMMVP
Download sequence
Identical sequences A0A091PV59

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]