SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091QWE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091QWE7
Domain Number 1 Region: 13-268
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.73e-68
Family Ankyrin repeat 0.0000464
Further Details:      
 
Domain Number 2 Region: 245-364
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000363
Family Ankyrin repeat 0.01
Further Details:      
 
Domain Number 3 Region: 455-501
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000314
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091QWE7
Sequence length 531
Comment (tr|A0A091QWE7|A0A091QWE7_9GRUI) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:KFQ30951.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_01368 OC=Mesitornis.
Sequence
MDFTEAYSDRCSAVGLAARQGNIKMLRKLIKQGYSIDVPDNRGWMPIHEAAAHNSSECLR
LLVRAAPSRDYINSKTFEGTCALHLSARHGSLEGVRVLLEAGADPNEITTEATNALFLAV
ENGHADIVKFLLQREANVEGPHSWSGWNSLHQAAFQGRTEIMKILLEKGASKECKDDFGI
TPLFIAAQYGKLETLRLLISHGADVNCQAKDRATPLLIASQEGHVECVELLLSKGADPNI
YCNEDNWQLPIHAAAEMGHKKILELLIPVTDRICDKGKGKVSPVYSAVYGGNKECLEMLL
KEGYSPDAQECPDFSCRSPMCMVFQKKFFYFVDVFLKYGIALLGMDLGYCLFHEKFTLFR
RFLKLGCSLPSGDELPEFISYTIKVHEEYKEWMPYLLLAGFNPVNVMERFWIFFVNKNAL
NFILEFTNWKRLPLSVEQHLSDCKEECTWTPKSHFAFIPSLSHLCRLEIRSILTCERLRS
DWFIRELPLPPPLQDYLLYFDVLRAHGITEVEHYLRQREEGAPSSTHSSAE
Download sequence
Identical sequences A0A091QWE7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]