SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091RED5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091RED5
Domain Number 1 Region: 821-898
Classification Level Classification E-value
Superfamily DEATH domain 6.67e-22
Family DEATH domain, DD 0.0000127
Further Details:      
 
Domain Number 2 Region: 219-270
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000968
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 3 Region: 129-220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000189
Family I set domains 0.021
Further Details:      
 
Domain Number 4 Region: 273-327
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000118
Family TSP-1 type 1 repeat 0.00063
Further Details:      
 
Domain Number 5 Region: 22-124
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000081
Family I set domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091RED5
Sequence length 900
Comment (tr|A0A091RED5|A0A091RED5_9GRUI) Netrin receptor UNC5B {ECO:0000313|EMBL:KFQ37632.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_06944 OC=Mesitornis.
Sequence
TGLEYSDVLPDSFPSAPAETLPHFLLEPQDAYIVKNKPVELVCRANPATQIYFKCNGEWV
NQNDHVTKESLDEVTGMLVREVQIEVYRQQVEELFGLEDYWCQCVAWSSAGTTKSRRAYV
RIAYLRKNFDQEPLGKEVPLEHEVLLQCRPPEGVPQAEVEWLRNEDVIDPTQDTNFLITI
DHNLIIKQARLLDTANYTCMAKNIVAKRRSTTAAVIVYVNGGWSTWSEWSPCNNRCGRGW
QKRTRTCTNPAPLNGGSFCDGQPLQKITCTTLCPVDGAWTEWSKWSACSTECTHWRSREC
AAPAPRNGGKDCSGVLLDSKNCTDGLCLQMLEATGDVALYAGLVVAIFVFIVILMAVGVV
VYRRRCRDFDTDITDSSAALTGGFHPVNFKTSRHDNPQLLHPSMQPDLTASAGVYRGPMY
ALQDSSDKIPMTNSPLLDPLPNLKIKVYNSSTASSSLGLHDGTDLLGGVPATGTYPGDNT
RDGHFANVRNKALGSQHLHSLPREHGNSASGTFGYLGGRLTIPGTGVRLLVPHGAIPQGK
FYEMYLVLNKAENALLPSEGTQTVLSPAVTCGPTGLLLCRPIVLTIPHCADVASSDWIYK
LKTQSHQGNWEEVVTLDEETLNTPCYCQLEAKSCHVLLDQLGTYVFVGESYSRSAIKRLQ
LAIFAPTVCTSLEYSLKVYCLEDTPDALKEVLELERTLGGYLLEEPKPLPFKDSYHNLRL
SIHDIPHALWRSKLLAKYQEIPFYHIWSGSQRALHCTFTLERYSQASTELTCKICVRQVE
GEGQIFQLHITLGEHASSFDTLHSYHSGTTTTSTTQMGPYAFKIPTSIRQKICNSLDAPN
SRGNDWRLLAQKLSMDRYLNYFATKASPTGVLLDLWEAEHQDDGDLNTLASALEEMGKSE
Download sequence
Identical sequences A0A091RED5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]