SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091RKC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091RKC2
Domain Number 1 Region: 7-218
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.04e-52
Family Reprolysin-like 0.00099
Further Details:      
 
Domain Number 2 Region: 309-365
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.57e-16
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 3 Region: 622-675
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 4 Region: 673-711
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000301
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091RKC2
Sequence length 714
Comment (tr|A0A091RKC2|A0A091RKC2_9GRUI) A disintegrin and metalloproteinase with thrombospondin motifs 1 {ECO:0000313|EMBL:KFQ39727.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_05861 OC=Mesitornis.
Sequence
RKKRFVSSPRYVETMLVADQSMAEFHGSGLKHYLLTLLSVAAKLYKHPSIRNSISLVVVK
IMVIYEERKGPDISSNAALTLRNFCSWQKQHNPPSDRHAEHYDTAILFTRQDLCGAKTCD
TLGMADVGTVCDLNRSCSIIEDDGLQAAFTTAHELGHVFNMPHDDAKQCAGINGISRDFH
MMASMLSNLDRSQPWSPCSAYMITTFLDNGHGECLLDKPHKPIQLPSDLPGTLYDANRQC
QFTFGDESKHCPDAASTCTTLWCTGTSGGLLVCQTKHFPWADGTSCGEGKWCMNGKCVNK
TEKKHYDTPVHGGWGSWGAWGECSRTCGGGVQYSFRECDNPVPRNGGKYCEGKRVQYRSC
NIEDCPDNDGKTFREEQCEKHNEFSKSPFGSGPAVEWTPKFAGVSPKDRCKLVCQAKGTG
YFFVLQPKVVDGTLCSPDSTSVCVQGQCVKAGCDRMIGSNKKFDRCGICGGNGSTCKKVS
GTLVRAKPGYHDVVIIPAGATNIEVKQRNHRGARHDGSFLAIKAADGTYILNGDYTLSTL
EQDITYKGSVLRYSGSSAALERIRSFSPLKEPLTIQVLTVGDLPQPKIKFTYFVKKPAQP
ASEKVPSRKKESFNAIREIISSEWVIEEWGECSKSCGSGWQRRAVECRDPQGRPAADCAR
ELKPSDVRPCADMPCPQWQLGDWSPCSKTCGKGFKKRLLKCISYDGSVLPQESC
Download sequence
Identical sequences A0A091RKC2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]