SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091RNC9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091RNC9
Domain Number 1 Region: 46-94
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000994
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 2 Region: 8-49
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000981
Family Somatomedin B domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091RNC9
Sequence length 237
Comment (tr|A0A091RNC9|A0A091RNC9_9GRUI) Somatomedin-B and thrombospondin type-1 domain-containing protein {ECO:0000313|EMBL:KFQ30022.1} KW=Complete proteome; Reference proteome OX=54374 OS=Mesitornis unicolor (brown roatelo). GN=N332_01112 OC=Mesitornis.
Sequence
CCEGRDAACVGEGWREGGGYGTCYCDGGCRRAGDCCHDHGQACPAIPCVVGEWSHWSGCA
EQCQPGLRIRRRYVQQEPKNGGEPCPALEEKAGCLEYLTYQGEDCGHEHVPAFITTSEYG
KERKRRAVSSLWPSDKEAPGYCVEFKTESLSHHCALENRPYARWMQYIREGHTVCVACQP
PAMNSDTHRCSGDGHNADGGKILHWEAVGNSQCQGTWKKIRQLEHCSCPLVHSFIFT
Download sequence
Identical sequences A0A091RNC9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]