SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091SJ40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091SJ40
Domain Number 1 Region: 11-262
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.84e-68
Family Ankyrin repeat 0.0000464
Further Details:      
 
Domain Number 2 Region: 239-358
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000477
Family Ankyrin repeat 0.011
Further Details:      
 
Domain Number 3 Region: 448-495
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000222
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091SJ40
Sequence length 538
Comment (tr|A0A091SJ40|A0A091SJ40_9AVES) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:KFQ58654.1} KW=Complete proteome; Reference proteome OX=36300 OS=Pelecanus crispus (Dalmatian pelican). GN=N334_14454 OC=Pelecanus.
Sequence
YSDRCSAVGLAAREGNVKMLRKLIKQGYSIDVADNRGWVPIHEAAARDSSECLRLLVRAA
PSDDYINSKTFEGMCALHLSARHGSLESVRVLLEAGADPNEVTTEATTALFLAVENGHAD
IVKFLLQHGANVKGPHSWSGWNSLHQASFQGCTEIMKILLEEGASKECKDDFGITPLFVA
AQYGKLESLRLLVSHGADVNCQAKDRATPLLIAAQEGHVECVELLLSKGADPNLYCNEDN
WQLPIHAAAEMGHKKILELLIPITDRICDKGKGKVSPVYSAVYGGNKECLEMLLKEGYSP
DAQECLNFDCRSPMCMVFQKEFFYFIDIFLQYGITLLGINLGYCLFHEKFALFQRFLKLG
CSLPSGEQLLEFISYSVKAHEEYKEWLPYLLLAGFNPVNLMCRFWIFSVTENALNFILEF
TNWKRLPPAVEQDLSDYKEKFTWTPKSHFAFIPSLSHLCRLEIRSILTSERLRSDRFIRE
LPLPACLQDYLLYLDVLRVNAIPEAEDYLGQREEGAPSTSHSSAEDAERRDACNAGVR
Download sequence
Identical sequences A0A091SJ40

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]