SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091T118 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091T118
Domain Number 1 Region: 25-66
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000785
Family Fibronectin type I module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091T118
Sequence length 332
Comment (tr|A0A091T118|A0A091T118_NESNO) Uncharacterized protein {ECO:0000313|EMBL:KFQ49884.1} KW=Complete proteome; Reference proteome OX=176057 OS=Nestor notabilis (Kea). GN=N333_04478 OC=Coelurosauria; Aves; Neognathae; Psittaciformes; Psittacidae; Nestor.
Sequence
CVSGCVCPHNQVLDGKGGCIEPEDCPCVHNGNSYTPGESIRVGCNNCTCRNRKWHCSDEP
CLETCSVYGDGHYTTFDGKRFDFEGDCEYVLIQNYCGQQGMNQGTFRVITENIPCGTTGT
TCSKSIKVFLGVSIFFNKFDGYSDVIQRTPGGKMPFQIRSMGIYLVVDTTVGLILMWDRK
TSIFIKLSPSFEGHVCGLCGNYDGNGNNDFTTRSQSVVGNVLEFANSWKVSSSCPNANRT
KDPCTANPYRKAWAQKQCSIITSEVFAKCHSQVEPNEFYEACIDDACACDTGGDCECFCT
AVAAYAQACNELDICISWRTPSICPLFCDYYN
Download sequence
Identical sequences A0A091T118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]