SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091TY48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091TY48
Domain Number 1 Region: 16-268
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.26e-69
Family Ankyrin repeat 0.0000352
Further Details:      
 
Domain Number 2 Region: 245-371
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000118
Family Ankyrin repeat 0.01
Further Details:      
 
Domain Number 3 Region: 454-501
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000249
Family SOCS box-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091TY48
Sequence length 544
Comment (tr|A0A091TY48|A0A091TY48_PHORB) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:KFQ83404.1} KW=Complete proteome; Reference proteome OX=9218 OS=Phoenicopterus ruber ruber. GN=N337_06767 OC=Phoenicopteridae; Phoenicopterus.
Sequence
MDFTEAYSDRCSAVGLAAREGNVKMLRKLIKQGYSVDVPDNRGWMPIHEAAAHNSSECLR
LLVRAAPSDNYINSKTFEGMCALHLSARHGSLESVRVLLEAGADPNEVTTEATTPLFLAV
ENGHADIVKFLLQHGANVKGLHSWSGWNSLHQASFQGCTEIMKILLEKGASKECEDDFGI
TPLFVAAQYGKLESLRLLVSHGADVNCQAKDRATPLLIAAQEGHAECVELLLSKGADPNL
YCNEDNWQLPIHAAAQMGHKKILELLIPITDRICDKGKGKVSPVYSAVYGGNKECLEMLL
KEGYSPDAQECLSFDCRSPMCMVFQKEFFYFIDTLLNYGITLLGIDLGYCLFHEKFTLFQ
RFLKLGCSLPSGDQLSEFINYTIKAHEKYKEWLPYLLLAGFNPVNLMRRFWIFSVSENAL
NFILEFTNWKRLPPAVEQDLSDYKEKFTWTPKSHFAFIPPLSHLCRLEIRSILTSERLRS
DRFIRELPLAACLQDYLLYLDVLRVNAIPAAEDYLGQREEAPPSTSLPSTEDAERRDACN
TGSR
Download sequence
Identical sequences A0A091TY48

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]