SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091URC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091URC8
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily EF-hand 3.41e-46
Family Calmodulin-like 0.0000000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091URC8
Sequence length 168
Comment (tr|A0A091URC8|A0A091URC8_NIPNI) Neuronal calcium sensor 1 {ECO:0000313|EMBL:KFQ92957.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_02061 OC=Nipponia.
Sequence
TEKEVQQWYKGFIKDCPSGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEF
SEFIQALSVTSRGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEE
NTPEKRVDRIFAMMDKNADGKLTLQEFQEGSKADPSIVQALSLYDGLV
Download sequence
Identical sequences A0A091F8R7 A0A091GMR1 A0A091JWR6 A0A091N8E3 A0A091RND2 A0A091SLZ0 A0A091URC8 A0A093GBD4 A0A093IT46 A0A093PK89 A0A0A0ARM2 A0A286Y292 A0A2K5HGC9 F6UG99 F7HEH1 G1MCI4 L8HRE8
ENSDNOP00000026476 ENSDORP00000012979 ENSGGOP00000001194 ENSGALP00000020720 9031.ENSGALP00000020720 9544.ENSMMUP00000027322 9796.ENSECAP00000020467 ENSMMUP00000027322 ENSDORP00000012979 ENSAMEP00000017062 ENSECAP00000020467 ENSSTOP00000020944 ENSGGOP00000001194 ENSMMUP00000027322 ENSECAP00000020467 XP_007442850.1.37977 XP_009077668.1.14518 XP_010023139.1.70042 XP_010146412.1.22856 XP_010176902.1.17318 XP_010207883.1.23224 XP_017529746.1.32401 ENSAMEP00000017062 ENSSTOP00000020944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]