SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091V336 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091V336
Domain Number 1 Region: 2-96
Classification Level Classification E-value
Superfamily PX domain 1.7e-24
Family PX domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091V336
Sequence length 109
Comment (tr|A0A091V336|A0A091V336_NIPNI) Sorting nexin-12 {ECO:0000313|EMBL:KFQ97205.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_03644 OC=Nipponia.
Sequence
LQTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEE
SFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEETIDRNYVPGKVRQ
Download sequence
Identical sequences A0A087RI62 A0A091EWU9 A0A091IFA0 A0A091J0J8 A0A091KQQ3 A0A091V336 A0A093EPR3 A0A093P7X8 A0A093PKZ3 A0A099ZMR3 A0A0A0A7S2 G1MTJ7 R0LSU6
ENSMGAP00000001738 ENSMGAP00000001738 ENSAPLP00000014387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]