SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091VYG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091VYG4
Domain Number 1 Region: 2-28
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000147
Family ATI-like 0.031
Further Details:      
 
Domain Number 2 Region: 19-67
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000023
Family Fibronectin type I module 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A091VYG4
Sequence length 337
Comment (tr|A0A091VYG4|A0A091VYG4_NIPNI) Mucin-5B {ECO:0000313|EMBL:KFR08244.1} KW=Complete proteome; Reference proteome OX=128390 OS=Nipponia nippon (Crested ibis) (Ibis nippon). GN=Y956_06698 OC=Nipponia.
Sequence
TECVSGCMCPDGLVLDGSGRCIPKDQCPCVHGGHFYKPGETIKVDCNTCTCNKRQWNCTD
NPCKGTCTVYGNGHYMSFDGEKFDFLGDCDYILAQDFCPNNMDAGTFRIVIQNNACGKSL
SICSLKITLIFEVCLELIITEELLLEGRIQEIDTDPGAEKNYKVDLRGGYIVIETNQGMN
FMWDQKTTVVVHVAPSFQGKVCGLCGDFDGRSRNDFTTRGQSVEMSIQEFGNSWKITSTC
SNINMTDLCADQPFKSVLGQKHCSIIKSNIFEACHSKVNPIPYYESCISDFCGCDSVGDC
ECFCTSVAAYSRSCSRAGVCIDWRTPAICPVFCDYYN
Download sequence
Identical sequences A0A091VYG4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]