SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091W8T5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091W8T5
Domain Number 1 Region: 1119-1294
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.44e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00058
Further Details:      
 
Domain Number 2 Region: 681-795
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-34
Family Pyk2-associated protein beta ARF-GAP domain 0.002
Further Details:      
 
Domain Number 3 Region: 890-1033
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-19
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 4 Region: 467-571
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-18
Family Pleckstrin-homology domain (PH domain) 0.0000388
Further Details:      
 
Domain Number 5 Region: 582-696
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000367
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 6 Region: 1429-1561
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000375
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 
Domain Number 7 Region: 8-71
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000482
Family SAM (sterile alpha motif) domain 0.00038
Further Details:      
 
Domain Number 8 Region: 1010-1111
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000849
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091W8T5
Sequence length 1689
Comment (tr|A0A091W8T5|A0A091W8T5_OPIHO) Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 2 {ECO:0000313|EMBL:KFR11465.1} KW=Complete proteome; Reference proteome OX=30419 OS=Opisthocomus hoazin (Hoatzin) (Phasianus hoazin). GN=N306_13443 OC=Opisthocomus.
Sequence
MSSTGNGTDIQEFLVNINLGQYLPNFKEYGYNIVTDCVGINNSVLQQMGVLPTGHRRRIL
KQLDTTLSKMRGNSLLRENLKLKDWKGLEEKQYSSLDQESPISNSSADGTSLIPATLSEQ
LLNKANDDKERFVLAEQNLAEANDDSFTNSDLSSLYQNSDNIRKAINLSGSVMMNTRPDT
SLEEAAAYQADEHLAGCLAFHDHPSSFTHSCETKYSENKHLMFADEDDLFDSEPNSPFFK
FKGEMVDNDLYDSYTQNCMKVFPRASRSFILRHRPVPEIPESSKVQASSSSLQKRRNVDP
ENISCTGRQISQNEEKPPIISPYGETFICDNPNDAKWFDKMGADALLRSPVCTWLLLREE
REERGSTASPPNSSNNQEEKIKEFAKNESVSQENKSLSPEEPENESVYSIVEQCSLPLKK
KENKAKTHSASCSKMQSGDSYRLVSEQMHFQQFDGDQTPIGKESITPYACFYGPSVKKVK
AGWLDKLSPQGKRMFQKRWVKFDGDSISYYNNEKEVFSKGIILLSAIATVRVQGENKFEV
VTSPRTFVFRVDKEGKNDWVNMMLNALKSQSDNNSQSRTSVAPEKSGYLELKGYKAKIFI
LLQGNTVWICKNEQDFKTGFGITLIPMNVANVKQVDRTAKQSFEIITPYKSFSFTAESER
EKQDWIEALQQSIAETLSDYEVAEKIWFNESNRSCADCKAPSPDWASINLCVVICKKCAG
QHRSLGPRDSKVRSLKMDASIWSNELIELFIIIGNKRANSFWAGNLPPDEELHMDAPAEK
RIAFITQKYREGKFRKAPFTYKTKEQLNKALCAAVVKQDVLETLMLLFSGADAMCATGDP
VYSTPYLLAKKAGQRLQMEFLYHNKFSDFPNYDTCFESGFSEHSSHSTFLCEFLYKVSSN
IPKLLTEKKLKEDCNKRWCTLESGFLSYYENDRTTTPHGMIDINEVICLVVHKSDFFLNR
RDIFTFEIYLMSERIFLFGAETAYSQRKWTSAIAKHFVPPVAECLLERDCDLIGQLYYKD
CHNLDQWRKGWFAIEKSSLYFCLEMENAEEDSIYLRRLQELTISSVMQNGEKIDVLLLVE
KGRTLYIHGHTKLDFMAWYTAIEKAAGTDGNALQDQQLSKNDIPIIVNSCIAFVTQYGLG
SKQIYLKNGDSSNVAELLESFKKDARSVKLRAGKHQLEDVTDVLKNFLSQIDDALLTKEL
YPFWISALDTQNEKERVRKYGAFIRTLPPVNRATLAALIEHLYRVQKCSEINHMNLHNLA
MVFSSCLFQTKGQTSEEVNVIEDLIKNYVQLFNINEDQVKQMDIENSFITRWKDTQVSQA
GDLLIEVYVERKEPDCSVIIRVSPLTEAEELTNDVLGIKNIIPNKYDIWAAFEVLENGEL
ERPLHYTENVLEQVLHWSSLPEPGTAYLIIKRFLTADMIKLYSEKNEKGSVKAGNLKYKE
EPSKLLSGNKFQERYFVLREGNLLLYKDMKASKPEKVLPVNSLKLYLGVKKKMKPPTNWG
LAVFSEKHQWYICCDGQDVQMEWMISIFTAQHADICPPAGKARKQSITKSPKVGGLPLIP
IQQEKNTYKIRGSTENIQLQSGKQKFGEHRENDFLEERKNLKEKASIVAQCLEWKEEKVR
NHGRTHRSLISVEDVGAGMTDLHQRPHKAVKKNKNKTNKATLELDNKLPSNVIQELNTVL
QKNRALHDE
Download sequence
Identical sequences A0A091W8T5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]