SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091WEK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091WEK5
Domain Number 1 Region: 5-72
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000105
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number 2 Region: 68-109
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000753
Family Fibronectin type I module 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091WEK5
Sequence length 109
Comment (tr|A0A091WEK5|A0A091WEK5_OPIHO) WNT1-inducible-signaling pathway protein 3 {ECO:0000313|EMBL:KFR13550.1} KW=Complete proteome; Reference proteome OX=30419 OS=Opisthocomus hoazin (Hoatzin) (Phasianus hoazin). GN=N306_11298 OC=Opisthocomus.
Sequence
ELCHWPCRCPPVPACTPGVSLVKDGCGCCKVCAKQSGESCNEADICDPHKGLYCDYSADE
PRYETGVCAHLVAVGCELNGVHYLNGQPFQPSPLYKCLCVSGAIGCTPV
Download sequence
Identical sequences A0A091WEK5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]