SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A091WXM5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A091WXM5
Domain Number 1 Region: 13-268
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.02e-68
Family Ankyrin repeat 0.0000534
Further Details:      
 
Domain Number 2 Region: 245-367
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000338
Family Ankyrin repeat 0.011
Further Details:      
 
Domain Number 3 Region: 454-500
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000235
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A091WXM5
Sequence length 543
Comment (tr|A0A091WXM5|A0A091WXM5_OPIHO) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:KFR06126.1} KW=Complete proteome; Reference proteome OX=30419 OS=Opisthocomus hoazin (Hoatzin) (Phasianus hoazin). GN=N306_15592 OC=Opisthocomus.
Sequence
MDFTEAYSDRCSAVGLAAREGNVKMLRKLIKQGYSIDVPDNRGWVPIHEAAAHNSSECLR
LLVHAAPSDDYINSKTFEGMGALHLSARHGSLESVHVLLEAGTDPNEVTTEATTALFLAV
ENGHADIVKFLLQHGANVQGPHSWSGWNSLHQASFQGCTEIMQMLLEKGANKECKDDFGI
TPLFVAAQYGKLESLRLLVSHGADVNCQAKDRATPLLIAAQEGHTECVELLLSKGADPNL
YCNEDNWQLPIHAAAEMGHKKILELLIPITDRICDKGKGKVSPVYSAVYGGNKECLEMLL
KEGYSPDAQECLNFDCRSPMCMVFQKEFFYFIDIFLKYGITLLGINLGYCLFHEKFTLFQ
RFLKLGCSLPSEDQLPEFISYTIKAHEEYKEWLPYLLLAGFNPVNLMQRFWIFSVSENAL
NFILEFTNWKRLPLAVEQDLSDREKFTWTPKSHFAFIPSLSHLCRLEIRSILTSERLRSN
RFIRELPLPACLQDYLLYLDILRANAIPEAEDYLRQREEGAPSASHSSAEDAERRDICNA
GAR
Download sequence
Identical sequences A0A091WXM5
XP_009929598.1.35112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]