SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093BSD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093BSD3
Domain Number 1 Region: 13-267
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.29e-67
Family Ankyrin repeat 0.0000563
Further Details:      
 
Domain Number 2 Region: 246-400
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000271
Family Ankyrin repeat 0.012
Further Details:      
 
Domain Number 3 Region: 455-501
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000222
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093BSD3
Sequence length 541
Comment (tr|A0A093BSD3|A0A093BSD3_9AVES) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:KFV06620.1} KW=Complete proteome; Reference proteome OX=240206 OS=Pterocles gutturalis (yellow-throated sandgrouse). GN=N339_11554 OC=Pterocles.
Sequence
MDFTEAYSDRCSAVGLAAREGDAKMLRKLIKQGYSIDVPDNRGWVPIHEAAAHNSTECLR
LLVHAAPSDDYINSKTFEGLCALHLSARHGSLECVRFLLEAGADPNELTTEATTALFLAV
ENEHADIVTFLLQHGANVRGPHCWSGWNSLHQASFQGCTEIMKILLEKGASKECQDDFGI
TPLFVAAQYGKLESLRLLVSHGADVNCRAKDRATPLLIAAQEGHVECVELMLSKGADPNL
YCNEDNWQLPIHAAAEMGHKKILELLIPVTNRICDKGKGKVSPVYSAVYGGNKECLEMLL
KEGYSPDAQECCNFYCRSPMCMVFQKEFFHFIDIFLKYGITLLGINLGYCLFHEKFDLFQ
RFLKLGCSLPSGDQLSEFISYTVKAQKEYKEWLPYLLLAGFNPVNLMCRVWIFSVSENAL
NFTLEFTNWKRLPPAVEQDLSDYKEKFTWAPKSHFAFIPSLSHLCRLEIRSILRSERLRS
DQFIRELPLPACLQDYLLYLDVLRGNAIAEAEGYLGQREEGAPSSSHPSAEDAARRDDCE
T
Download sequence
Identical sequences A0A093BSD3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]