SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093DSS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093DSS9
Domain Number 1 Region: 16-268
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-68
Family Ankyrin repeat 0.0000525
Further Details:      
 
Domain Number 2 Region: 245-367
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000555
Family Ankyrin repeat 0.01
Further Details:      
 
Domain Number 3 Region: 455-501
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000235
Family SOCS box-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093DSS9
Sequence length 544
Comment (tr|A0A093DSS9|A0A093DSS9_TAUER) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:KFV05221.1} KW=Complete proteome; Reference proteome OX=121530 OS=Tauraco erythrolophus (Red-crested turaco). GN=N340_09474 OC=Tauraco.
Sequence
MDFTEAYSDRCSAVGLAARKGNVEMLRKLIEQGYSVDVPDNRRWVPIHEAAAHNRSECLK
LLIRAAPSDDYINLKTFEGLCALHLSARYGSLESVRVLLEAGADPNEVTTEATTALFLAV
ENEHVDVVKLLLQHGANVKGPHSWSGWNSLHQASFQGCTEIMKILLEKGASEECVDDFGI
TPLFVAAQYGQLESLRLLISHGADINCQAKDRATPLLIAAQEGHTECVELLLSKGADPNL
YCNEEDWQLPVHAAAEMGHEKILELLIPVTDRICDKGEGKVSPVYSAVYGGNKECLEMLL
KEGYSPDAQECLNFDCRSPMCMVFQKEYFNFIDIFLKYGITLLGINLRHCLFHGKFTLFQ
HFLKLGCSLPSGDQLPEFLSSTLEAQQEYKEWLPYLLLAGFNPVNLMCRFWIFSVRENAL
NFILEFTNWKRLPPAVEQDLSDYKEESTWTPKSHFASIPSLSHLCRLEIRSLLTSERLRS
DRFIRELPLPACLQDYLLYLDVLRAYALPEAEDYLRQREERAPSTSDSSAEDAERRDSCS
ASSR
Download sequence
Identical sequences A0A093DSS9
XP_009984859.1.11325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]