SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093F0M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093F0M4
Domain Number 1 Region: 511-880
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.4e-127
Family Hect, E3 ligase catalytic domain 0.00000000364
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.79e-28
Family Synaptotagmin-like (S variant) 0.03
Further Details:      
 
Domain Number 3 Region: 458-496
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000223
Family WW domain 0.00013
Further Details:      
 
Domain Number 4 Region: 329-368
Classification Level Classification E-value
Superfamily WW domain 0.000000000000181
Family WW domain 0.0017
Further Details:      
 
Domain Number 5 Region: 170-211
Classification Level Classification E-value
Superfamily WW domain 0.00000000000115
Family WW domain 0.0013
Further Details:      
 
Domain Number 6 Region: 405-441
Classification Level Classification E-value
Superfamily WW domain 0.00000000000236
Family WW domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093F0M4
Sequence length 887
Comment (tr|A0A093F0M4|A0A093F0M4_TAUER) E3 ubiquitin-protein ligase NEDD4 {ECO:0000313|EMBL:KFV20236.1} KW=Complete proteome; Reference proteome OX=121530 OS=Tauraco erythrolophus (Red-crested turaco). GN=N340_04222 OC=Tauraco.
Sequence
ENTRIVRVKVIAGIGLAKKDILGASDPYVKVTAYDPVSGVLTSVQTKTIRKSLNPKWNEE
LLFRVNPQKHRLLFEVFDENRLTRDDFLGQVDIPLYQLPTENPSMERPYTFKDFVLHPRS
HKSRVKGHLRLKMTYLPKSNGSEEESTEQAEELEPGWIILDQPDAASQPQQQQQESPPLP
SGWEERQDILGRTYYVNHEFRRTQWKRPTAQDNVAVADVGSVQLEAQHVFTHRRQISEDT
ENLDNRDSPESWDIITEDEATMYSNQNLQIPLSQSNCDIQTHLAEELNTRLTTSGSSATG
QPAAYTNHSSRRGSLQTYRVEEQPAHPVLLPTSSGLPPGWEERQDEKGRSYYIDHNSRTT
TWIKPVVQIAVEASQLSAAQTISIVRQPQATSSDASQQSSQQQPEMEQGFLPKGWEVRHA
PNGRPFFIDHNTKTTTWEDPRLKISAHPRRKTSLDPVDLGPLPPGWEERTHTDGRIFFIN
HNTKKTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRKKLKKQSDIPNRFEMKIHRTTIL
EDSYRRIIAVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSAT
DNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDAFFIRPFYKMMLQKPITLHD
MESVDSEYYNSLRWILENDPAELDLRFVVDEELFGQTHQHELKSGGSEIVVTNKNKRDYI
HLVIQWRFVSRVQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVADWKLHTK
YKNGYNINHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTVE
QWGTPEKLPRAHTCFNRLDLPPYDSFEDLWDKLLLAIENTQGFDGVD
Download sequence
Identical sequences A0A093F0M4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]