SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093FII1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093FII1
Domain Number 1 Region: 13-265
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.01e-68
Family Ankyrin repeat 0.0000553
Further Details:      
 
Domain Number 2 Region: 242-340
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000801
Family Ankyrin repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 452-499
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000379
Family SOCS box-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093FII1
Sequence length 538
Comment (tr|A0A093FII1|A0A093FII1_TYTAL) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:KFV54111.1} KW=Complete proteome; Reference proteome OX=56313 OS=Tyto alba (Barn owl). GN=N341_05375 OC=Coelurosauria; Aves; Neognathae; Strigiformes; Tytonidae; Tyto.
Sequence
MDFTEAYSDRCSAVGLAAREGNVKMLRKLIKQGYSIDVPDNRGWVPIHEAAAHNSGDCLR
VVVPPSDGYINSKTFEGMCALHLSARHGSLESVRILLEAGADPNEVTTEATTPLFLAVEN
GHVGIVKFLLQHGANVQGPHSWSGWNSLHQASFQGCTEILKILLEKGASKECKDDFGITP
LFVAAQYGKLESLRLLLSHGADINCQAKDRATPLLIAAQEGHTECVELLLSKGAEANLYC
NQDNWQLPIHAAAEMGHKKILKLLIPITDRICDKGKDKVSPVYSAVYGGNRECLEMLLKE
GYSPDAQECLNFNCRSPMCMVFQKEFFYLIDILLKYRITLLGINLGYCLIHEKFTLFQRF
LKLGCSLPSGDQLLEFISYTIKVHKEYKQWLPYLLLAGFNPVNLLRRFWIFSVSENVLNF
ILEFTNWKRLPPAVEQDLSDYKEKFTWTPKSHFAFIPSLSHLCRLEIRSILTSEHLRSDR
FIRGLPLPACLQDYLLYLDVLRVNAIPGAEDYLGQREEGAPSTSHSSAEGAERRDACD
Download sequence
Identical sequences A0A093FII1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]