SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093GNE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093GNE4
Domain Number 1 Region: 13-267
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.41e-67
Family Ankyrin repeat 0.0000507
Further Details:      
 
Domain Number 2 Region: 245-373
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000307
Family Ankyrin repeat 0.011
Further Details:      
 
Domain Number 3 Region: 455-501
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000157
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093GNE4
Sequence length 544
Comment (tr|A0A093GNE4|A0A093GNE4_DRYPU) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:KFV68552.1} KW=Complete proteome; Reference proteome OX=118200 OS=Dryobates pubescens (Downy woodpecker) (Picoides pubescens). GN=N307_02237 OC=Coelurosauria; Aves; Neognathae; Piciformes; Picidae; Picoides.
Sequence
MDFTEAYSDRCSAVGLAAREGNVKMLRKLIKQGYSIDVPDNRGWVPIHEAAAHNSSECLR
VLIGAASSVDYINSKTFEGLCALHLSARHGSLESLHVLLESGADPNEVTTEATTPLFLAV
ENGHINTVKFLLQHGANIEGPHSWSGWNSLHQASFQGFTEIMEILLEKGASKECKDDFGI
TPLFVAAQYGQLESLRLLVSHGADVNCQAKDKATPLLIAAQEGHTQCVELLLAKGADPNL
YCNEDNWQLPIHAAAEMGHERILELLIPVTDRICDKGKGKVSPVYSALYGGNKECLVMLL
KAGYSPDAQECLSFDCTSPMCVVFQKGLFHFIDILLKYGITLLGINLGYCLFHEKFPLFQ
RFLKLGCSLPSGDQLQKFTNYTLKVHKEYKEWLPHLLLAGFNPVNLMCRFWIFLVSKDAL
DFMLEFTNWKRLPPAVEKDISDYKEKFAWTPKSHFAFIPSLSHLCRLEIRSILMSERLRS
DHFIRELPLPACLQDYLLYLDVLRLNDIPEVEDFLRQREEGAPSASHSSPKDEESRDACN
TGAR
Download sequence
Identical sequences A0A093GNE4
XP_009900370.1.92783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]