SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093H9J2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093H9J2
Domain Number 1 Region: 13-267
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.89e-66
Family Ankyrin repeat 0.0000662
Further Details:      
 
Domain Number 2 Region: 246-371
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000191
Family Ankyrin repeat 0.013
Further Details:      
 
Domain Number 3 Region: 454-501
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000249
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093H9J2
Sequence length 544
Comment (tr|A0A093H9J2|A0A093H9J2_STRCA) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:KFV78331.1} KW=Complete proteome; Reference proteome OX=441894 OS=Struthio camelus australis. GN=N308_02509 OC=Struthio.
Sequence
MDFTEAYSDRCSAVGLAAREGNVKMLRKLIKRGYSIDVPDNRGWMPIHEAAVHNSSECLR
LLICAAPSDNYIKSETFEGMCALHLSASHGCLESVSILLEAGADPNEVTTEATTPLFLAV
ENGHSGIVKLLLQYGANINGHHSWSGWNSLHQASFQGYTEIIKILLEKGANKECEDDFGI
TPLFVAAQYGKLESLRMLVSYGANINCQAKDKATPLLIAAQEGHAKCAELLLSKGADPNL
YCNEEEWQLPIHAAAEMGHKNILELLLPLTDRICDRGKGKVSPVYSAIYGGNKECLEMLL
KQGYSPDAQKCLTFGCRSPMCMVFQKEFFDLIPVLLKYGITLLGINLGYCLYHGKFTLFR
RFLKLGCWLPSEDQIPEFVSYAIKAHEQYKEWLPYLLLAGFNPLNLLCKLWIYSVHEDAL
NFVLEFTNWKRLPPAVERNLSDYKESSTWIPNSHFVFIPSLSHLCRLEIRSILKSEHLRS
DQFIRELPLPACLQDYLLYLDILRVNAIPAVVESLDDSDEGIPPASCSSSEDAEKREACD
AGAR
Download sequence
Identical sequences A0A093H9J2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]