SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093HFU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093HFU4
Domain Number 1 Region: 113-144
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000837
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093HFU4
Sequence length 169
Comment (tr|A0A093HFU4|A0A093HFU4_STRCA) Uncharacterized protein C3orf30 {ECO:0000313|EMBL:KFV81498.1} KW=Complete proteome; Reference proteome OX=441894 OS=Struthio camelus australis. GN=N308_09807 OC=Struthio.
Sequence
VETPSSADQPPVVELPVSVDQLVLEKSPASDDQLPVVDFPPSPEDSHGDASPVSSVGDLP
GFKVKIHTSESAGAGAKALEAGSPTSVVMPTDTMSEILERSMVYEDPLEVSLRYMEKHNI
LQIFQEITEKLVYKKPDDPLQFMLLQVQSMINARQAEMEGILEEDEDAE
Download sequence
Identical sequences A0A093HFU4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]