SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093HMN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093HMN6
Domain Number 1 Region: 502-871
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.62e-127
Family Hect, E3 ligase catalytic domain 0.00000000376
Further Details:      
 
Domain Number 2 Region: 5-141
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-29
Family Synaptotagmin-like (S variant) 0.037
Further Details:      
 
Domain Number 3 Region: 449-487
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000445
Family WW domain 0.00016
Further Details:      
 
Domain Number 4 Region: 321-360
Classification Level Classification E-value
Superfamily WW domain 0.000000000000195
Family WW domain 0.0017
Further Details:      
 
Domain Number 5 Region: 396-432
Classification Level Classification E-value
Superfamily WW domain 0.00000000000236
Family WW domain 0.00097
Further Details:      
 
Domain Number 6 Region: 178-203
Classification Level Classification E-value
Superfamily WW domain 0.0000129
Family WW domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093HMN6
Sequence length 878
Comment (tr|A0A093HMN6|A0A093HMN6_GAVST) E3 ubiquitin-protein ligase NEDD4 {ECO:0000313|EMBL:KFV55853.1} KW=Complete proteome; Reference proteome OX=37040 OS=Gavia stellata (Red-throated diver) (Red-throated loon). GN=N328_07953 OC=Coelurosauria; Aves; Neognathae; Gaviiformes; Gaviidae; Gavia.
Sequence
ENTRIVRVKVIAGIGLAKKDILGASDPYVKVTVYDPVNGVLTSIQTKTIKKSLNPKWNEE
LLFRVNPQKHRLLFEVFDENRLTRDDFLGQVDIPLYQLPTENPSMERPYTFKDFVLHPRS
HKSRVKGHLRLKMTYLPKSNGSEEETMEQAEELEPGWIILDQPDAASQPQQQQPESQRQD
ILGRTYYVNHEFRRTQWKRPTAQDNVAVADIGSVQLEAQHVFTHRRQISEDTENLDNRDS
PESWEIITEDEATTYSNPNLQIPLSQSSCDIQTHLAEELNTRLTTSGSSATGQSAAFTNH
SSRRGSLQTYRVEEQPAHPVLLPTSSGLPPGWEERQDEKGRSYYIDHNSRTTTWIKPVVQ
IATEPGQLAAQSISIGRQLQATSSDSSQQSSQQQPEMEQGFLPKGWEVRHAPNGRPFFID
HNTKTTTWEDPRLKTSAHPRRKTSLDPVDLGQLPPGWEERTHTDGRIFFINHNTKKTQWE
DPRLQNVAITGPAVPYSRDYKRKYEFFRKKLKKQSDIPNRFEMKIHRTTILEDSYRRIIA
VKRADFLKARLWIEFDGEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINP
NSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDAFFIRPFYKMMLQKPITLHDMESVDSEYY
NSLRWILENDPTELDLRFIVDEELFGQTHQHELKSGGSEIVVTNKNKRDYIHLVIQWRFV
SRVQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVADWKLHTKYKNGYNINH
QVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTVEQWGTPEKLP
RAHTCFNRLDLPPYDSFEDLWDKLLLAIENTQGFDGVD
Download sequence
Identical sequences A0A093HMN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]