SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093J089 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093J089
Domain Number 1 Region: 510-879
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.09e-127
Family Hect, E3 ligase catalytic domain 0.00000000376
Further Details:      
 
Domain Number 2 Region: 5-140
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.28e-29
Family Synaptotagmin-like (S variant) 0.034
Further Details:      
 
Domain Number 3 Region: 457-495
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000209
Family WW domain 0.00013
Further Details:      
 
Domain Number 4 Region: 328-367
Classification Level Classification E-value
Superfamily WW domain 0.000000000000278
Family WW domain 0.0016
Further Details:      
 
Domain Number 5 Region: 404-440
Classification Level Classification E-value
Superfamily WW domain 0.00000000000236
Family WW domain 0.00097
Further Details:      
 
Domain Number 6 Region: 174-210
Classification Level Classification E-value
Superfamily WW domain 0.00000000000334
Family WW domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093J089
Sequence length 886
Comment (tr|A0A093J089|A0A093J089_FULGA) E3 ubiquitin-protein ligase NEDD4 {ECO:0000313|EMBL:KFW05312.1} KW=Complete proteome; Reference proteome OX=30455 OS=Fulmarus glacialis (Northern fulmar). GN=N327_13624 OC=Fulmarus.
Sequence
ENTRIVRVKVIAGIGLAKKDILGASDPYVKLTVYDPVNGVLTSVQTKTIKKSLNPKWNEE
LLFRVNPQKHRLLFEVFDENRLTRDDFLGQVDIPLYQLPTENPSMERPYTFKDFVLHPRS
HKSRVKGHLRLKMTYLPKSNGSEEETTEQAEELEVGKDVFIAEKPSKCLQLLRESPPLPS
GWEERQDILGRTYYVNHEFRRTQWKRPTAQDNVAVADIGSVQLEAQHVFTHRRQISEDTE
NLDNRDSPESWEIITEDEATMYSNQNLQIPLSQSNCDIQTHLAEELNTRLTTSGSSATGQ
SAAYTNHSSRRGSLQTYRVEEQPAHPVLLPTSSGLPPGWEERQDEKGRSYYIDHNSRTTT
WIKPAVQIATETSQLSAAQSISIGRQPQATSSDSSQQSSQQQPEMEQGFLPKGWEVRHAP
NGRPFFIDHNTKTTTWEDPRLKISAHLRRKTSLDPVDLGPLPPGWEERTHTDGRIFFINH
NTKKTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRKKLKKQSDIPNRFEMKIHRTTILE
DSYRRIIAVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATD
NYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDAFFIRPFYKMMLQKPITLHDM
ESVDSEYYNSLRWILENDPTELDLRFVVDEELFGQTHQHELKSGGSEIVVTNKNKRDYIH
LVIQWRFVSRVQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDVADWKLHTKY
KNGYNINHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTVEQ
WGTPEKLPRAHTCFNRLDLPPYDSFEDLWDKLLLAIENTQGFDGVD
Download sequence
Identical sequences A0A093J089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]