SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093KYJ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093KYJ9
Domain Number 1 Region: 52-177
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.89e-46
Family Regulator of G-protein signaling, RGS 0.000000645
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A093KYJ9
Sequence length 178
Comment (tr|A0A093KYJ9|A0A093KYJ9_FULGA) Regulator of G-protein signaling 4 {ECO:0000313|EMBL:KFW02376.1} KW=Complete proteome; Reference proteome OX=30455 OS=Fulmarus glacialis (Northern fulmar). GN=N327_07790 OC=Fulmarus.
Sequence
MCKGLAALPATCLKSAKDMKHRLGFLLQKSDSCDYSSSQGKKEKISSSQRVSQEEVRKWA
DSLENLIHHDRGLAAFRAFLKSEYSEENIEFWVSCEDYKKTKSPAKLSPKARKIYDEFIS
VQATKEVNLDSCTREKTSHNMLEPTLSCFDEAQRKIFTLMEKDSYRRFLKSPYYLDLV
Download sequence
Identical sequences A0A091LIP7 A0A091PVS8 A0A091RA65 A0A091SL14 A0A093KYJ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]