SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A093LIP0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A093LIP0
Domain Number 1 Region: 2189-2369
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.41e-33
Family Laminin G-like module 0.00092
Further Details:      
 
Domain Number 2 Region: 2015-2187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.51e-28
Family Laminin G-like module 0.0008
Further Details:      
 
Domain Number 3 Region: 2377-2568
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.16e-23
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 4 Region: 684-736
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000159
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 5 Region: 734-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000019
Family Laminin-type module 0.0015
Further Details:      
 
Domain Number 6 Region: 627-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000223
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 7 Region: 1288-1339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 8 Region: 1346-1396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000247
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 9 Region: 155-214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000339
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 10 Region: 929-977
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 11 Region: 787-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 12 Region: 1394-1438
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000176
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 13 Region: 583-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000246
Family Laminin-type module 0.081
Further Details:      
 
Domain Number 14 Region: 354-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000109
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 15 Region: 836-885
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000145
Family Laminin-type module 0.0089
Further Details:      
 
Domain Number 16 Region: 880-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000865
Family Laminin-type module 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A093LIP0
Sequence length 2639
Comment (tr|A0A093LIP0|A0A093LIP0_FULGA) Laminin subunit alpha-1 {ECO:0000313|EMBL:KFW08846.1} KW=Complete proteome; Reference proteome OX=30455 OS=Fulmarus glacialis (Northern fulmar). GN=N327_08456 OC=Fulmarus.
Sequence
VFQVAYVIIKAANAPRPGNWILERSIDGTEFRPWQYYAISDTECLTRYNITPRIGPPTYK
RDDEVICTSYYSRLVPLEHGEIHTSLINGRPSADDPSQKLLEFTSARYIRLRLQRIRTLN
ADLMTLSHNDPKELDPIVTRRYYYSIKDISVGGMCICYGHARSCPLDEITKKLQCQCEHN
TCGESCNECCPGYHQKPWRPGTISAGNKCEKCNCHNKAEDCYYNQSIADQERSMDIHGQY
TGGGVCLNCTQHTTGINCEMCADGYFRPHKVSPYEDHPCYPCGCDQFGSLSSDCVKDEHH
SNSQHGTWPGQCQCREGYTGEKCDHCAFGYRGYPNCLRCNCSLIGSINEDPCTEPCLCKE
NVEGENCDLCKPGFYNLQERNPQGCTECFCFGVSDVCDSLTWPISQISDMTGWLVTDLYN
ARSVQPQRSQFDGPRQISINNTEAVKVLKHTYYWSAPESYLGNKLTAFGGDLRYTVSYDI
PMESVDSDIVSSVDVIIQGNGQILSTRAAGLSLQPYEEYSNAVRFVSENFIDFNTKKAID
RERLMTVLVNVTHVLIRANYNIAKKAVYRLDSVTLDTASTNIIDLSSAPDVEFCECPQGY
TGISCESCLPGYYRVDGILFGGICQPCKCNGHATECDIHGVCFACQHNTTGPFCDQCLPG
FYGSPSQGTSEDCQPCACPLSSAANNFSPTCQLSEGGGIVCDNCLPGYTGSQCERCANGY
YGNPLIPGQSCAPCECNGNVNPQEDGHCDTFTGQCLKCLGNTAGHHCEKCADGYYGDAVI
EKSCRACACHVNGSLSSTCHHETGFCHCKSNVIGERCDKCLNGYYGLLTELGCIPCNCSQ
FGSVSEDCNHQGQCHCVPGVAGEKCDRCAHGFHAFQDGGCTPCDCAHTQNNCNADSGQCI
CPPHTRGPKCELCEENHWGLSPKLGCKACNCSDTGSTNLQCDVLTGQCHCKVEFGGQDCS
RCALGYRDYPDCVACDCDLSGTKAEMCDDTEGLCGCEEETGICTCKENVFGLQCSECKPG
TFALSANNALGCVPCFCFGMSTFCSELEDHVRIPITLTPDQSILHVVAQSNLTGTVEGVF
SQFPDVLLDAAIVRKYLNTETFYWKLPEQFQGDRLMAYGGKLRYTIAFYALDGFGTSNFE
PQILMKGGHASRLVIYVDIPSPENGVRTDKEVEMKEDSWKYFNSVSDEPVLRSDFMSVLS
NVEYILIKAAYGQGLQQSRIANISMEIAVKFEEMHLGRARAHLVEQCRCPAGYAGLSCQS
CAPGYYRGKHTELGVKEPHTLIAACVPCQCNNHSETCDPETGRCLNCRDNTVGDYCSACA
PGYYGKVIGSVNDCSLCACPRANPVSFSPTCVLKGVQDYHCDACLPGYEGQYCERCSLGY
YGDPQLPGGSCHPCQCSPSGSVHVKCDHATGQCLCKQGVTGRLCEECEPRHLLVEDECVS
CDDNCTGVLLNSLDNLNKAIFSMNLTGVARVPYGILSELENAAKHLKGSIVPREDPTYSL
ATAKESLLSLSGGIDQLHEESSRFLKKAWKLNKMTQETSNKSQELTGFIDTVHTTIKVLA
EVAMSLNETLGLDLPLSNATSQSLQDDISALLDALRKKDFVQQHHNATSVLKAAENLLIH
VQKEYLKPQQELAELKNDASQLLSKHNSRLQDAQDLVNEALTNINETSRLFPLISSNLAE
LNDKKLNIKEGEEVSTMLIKEGKVLVNAAAALAQDVKNSTSNLEVHQDGLGLWSTKLRHH
VDELVMQMSVRGVLDLVYRAEDHATQFQRLADALESGLSKVRNVTLNTTAAVYTHSSVKS
VIERTESLADDASRVVNGPLDLPEESLSRLGKETLLLSSKFQNEAKNLKKKSDGLLFGLN
GLNKKVEMIQESTNKIVSQLNDSLLTLRALPNDTRKYMLEVKELAVSANTGAVVGLSQFG
DFSQKLLNTSSTLSRVNDTLRKTSELITDSSKAAITAGKQVKEVEAQASLLLDRLKPLKM
LEENLNRNLSEIKELISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTAE
SDNLLFYLGSNGKTDFLAVEMRRGKVALLWDLGSGSTRVEYPDFQIDNNKWHRIHATRFG
KTGTLSIEEMNSSQKPSSKSATSPGTASILDVNKSTLMFFGGLGGQIKKSPAVKVTHFKG
CMGEASLNGKSIGLWNYMEREGKCNGCFGSPQDEDTSFHFDGSGYSVVEKALRSTVTQII
IFFSTFSPNGLLLYLASNGTRDFLSLELVDGKVRLTVDLGSGPLALTTENCYNNGTWYKI
SFSRNKKQGILAVMDAYNLNYKETKQGESLNRSDKDPIFIGGLPRSRTVRKGLNSRMYVG
CIKNLEISRSTFDLLRNSYGVRKGCVLEPIRSVNILNNGYIELVPKSLSPESELMATFAT
KNSSGIILAGLSKGLEKRRRRQAHLASIENEDFLPFFSIMLIDGHLAVHINAGERASTRK
VILQSANGTYSDGQEHSVILVRNKRIITVQVDESNPAELRLGASAEMSPMNISNFYAGGI
PAGEGLLGLKMAGSFRGCISNLIFNKELLYFTTSMKYEHVDMDSCFLSEKPKPAIQPEDI
EIQLELQALPVPLRPLTDTKKVVCAKDELPDHVQGAHQFGLAKGSHLTLLFNQSTVRKK
Download sequence
Identical sequences A0A093LIP0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]