SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094KRE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094KRE4
Domain Number 1 Region: 13-268
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.73e-68
Family Ankyrin repeat 0.0000456
Further Details:      
 
Domain Number 2 Region: 245-370
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000228
Family Ankyrin repeat 0.011
Further Details:      
 
Domain Number 3 Region: 454-501
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000222
Family SOCS box-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094KRE4
Sequence length 538
Comment (tr|A0A094KRE4|A0A094KRE4_9AVES) Ankyrin repeat and SOCS box protein 3 {ECO:0000313|EMBL:KFZ61155.1} KW=Complete proteome; Reference proteome OX=345573 OS=Podiceps cristatus (great crested grebe). GN=N338_04637 OC=Podiceps.
Sequence
MDFTEAYSDRCSAVGLAAREGNVKMLRKLIKQGYSIDVPDNRGWVPIHEAAAHNSSECLR
LLIRAAPSDDYVNSKTFEGMCALHLSARHGSLESVRVLLEAGADPNDVTTEATTPLFLAV
ENGHADIVKFLLQHGANVKGPHSWSGWNSLHQASFQGFTEIMKILLEKGASKECKDDFGI
TPLFVAAQYGKLASLRLLVSHGAAVNCQAKDRATPLLIAAQEGHAECVELLLANGADPNL
YCNEDNWQLPIHAAAEMGHKKILELLIPITDRICDKGKGKVSPVYSAVYGGNKECLEMLL
KEGYSPDAQECLNFDCRSPMCMVFQKEFFYFVDTFLKYGITLLGINLGYCLFHEKFTLFQ
RFLKLGCSLPSGDQLSEFLSYTIKAHEEYKEWLPYLLLAGFNPVNLMRRFWIFSVSEDTL
NFILEFTNWKRLPPAVEQDLSDYKEKFTWTPKSHFAFIPSLAHLCRLEIRSILTSERLRS
DRFIRELPLPACLQDYLLYLDVLRGNGVPAAEEYLGQRGEGAPSPSPPSAEDAERRDA
Download sequence
Identical sequences A0A094KRE4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]