SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A094ZL40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A094ZL40
Domain Number 1 Region: 29-266
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.58e-58
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 241-378
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000533
Family Ankyrin repeat 0.011
Further Details:      
 
Domain Number 3 Region: 458-500
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000131
Family SOCS box-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A094ZL40
Sequence length 539
Comment (tr|A0A094ZL40|A0A094ZL40_SCHHA) Ankyrin repeat domain-containing protein 6 {ECO:0000313|EMBL:KGB34707.1} KW=Complete proteome; Reference proteome OX=6185 OS=Schistosoma haematobium (Blood fluke). GN=MS3_02932 OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MHMRLSFTRSSTHQGQFILKELDNQSEKYRFVNNVRKRNHTDLCPVHLVAYKGNLAMLHY
LIQNGVNVHQPTCTLQRRPVHYAALRQQVSCLQMLLNAGAQIDARDTFGNTPLHYAAEDG
DGGLLSLLLNNGACVDAQDITNKTPLMKAARSGKVWAVRRLLLFGANVNVKDRNDETALH
FACRQGSTEITRMLIKAESRLNAQNQIGLTPLMESVSYNQREAVSLLIKHKDIDLYKRDF
CTGDTALHIAVKKNYIHIVEILLRAGNWYIEYNYNNLGESFVHDVVAYNRLELLRLFLAY
NYDLDRPAKRLPPNIHLLSSLNHQTLLKNTQNTITTSMIQSESNNRTSINPFEKSPFKMA
LERGHLDMARILAEVGCFCTHLPINSNSIPSVCATSSSSSSSSSSSSSSSSSSSSSSSSS
SSSNNNNIPETNSINSTVKNSHLINQNLLTRRYNGLLEVKSLQKWCRKVIRQRLGFRLIE
ALPLLPIPVPLKDFLLLRDIDWSIYLNNIHNNNNNNNNNNSNNRSSIINSGELAIIVPT
Download sequence
Identical sequences A0A094ZL40
XP_012794474.1.65645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]