SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095C9U0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095C9U0
Domain Number 1 Region: 98-278
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.49e-22
Family UAS domain 0.018
Further Details:      
 
Domain Number 2 Region: 338-433
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000336
Family UBX domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A095C9U0
Sequence length 488
Comment (tr|A0A095C9U0|A0A095C9U0_SCHHA) FAS-associated factor 2 {ECO:0000313|EMBL:KGB39078.1} KW=Complete proteome; Reference proteome OX=6185 OS=Schistosoma haematobium (Blood fluke). GN=MS3_07492 OC=Schistosomatoidea; Schistosomatidae; Schistosoma.
Sequence
MSGNDNIDEAHALSESEAQDVQHLREIAGGIGYLDALKLLEESSWNLERAVHKLMGFEDS
GLRQRGAASRISSVPQFYRNYFPYQASFLWSDPRNQVTDPVGDVRNFIQHFKETYGSVNT
SFDVDGNSNPTESSTSDSFPPFFEGTYADAVQEAKQSLRFLIVYLHGDSHEDTHRFCKDI
LQSEDVLRFLRNSNELLFWGCNIESPEGYRVSRTLREHTYPFIGVIGLTNIPISESGVYS
GSSTRMALLGRIEGVLEPSELVDQLNSILNEHQTAIITARLDRFIILRSTPSFNRSEREM
NAQLRREQDLAYEASLAEDRAKVAAREAQQRSAALVAEQLAKDAKRKEDLKKAHINRKRI
WQSRLPPPPKFEEGSTVQLSFKMPRGSRVSRVFNLNDSIKLLYYFVLSQDDSPTEFEVQS
NFPKRIIPCQPFEESDVEDYIDTPDNKMDCDEPEVITDWSRKCQNDPPSFFDIDLTRPEM
LFVLNKDA
Download sequence
Identical sequences A0A095C9U0
XP_012798838.1.65645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]