SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A095Z9L4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A095Z9L4
Domain Number 1 Region: 431-499
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000477
Family Atu1826-like 0.085
Further Details:      
 
Domain Number 2 Region: 12-98
Classification Level Classification E-value
Superfamily EsxAB dimer-like 0.0000654
Family ESAT-6 like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A095Z9L4
Sequence length 602
Comment (tr|A0A095Z9L4|A0A095Z9L4_9ACTO) Uncharacterized protein {ECO:0000313|EMBL:KGF05159.1} KW=Complete proteome; Reference proteome OX=1284680 OS=Actinomyces sp. S6-Spd3. GN=HMPREF1627_01380 OC=Actinomyces.
Sequence
MPTWSEIQLWKAATLSSYVDTVSSKKQTIDQQIATLQARRTSFQGEGQTADALRNAMSTA
HKELSNLAEELRHVHIAITQATSRVQQVESLVANALSSASARHCTISDSGTVTCTFGHDF
SVRHKLESEVQSMVRNAIRAAEQVDNDFRALLTNVGTARTAPAYRARGTHALSKAEEAAF
PKMTPQQRADYWSQQSDEQKKFLCDNYPDLIGNADGVEAWARDRANRRRLPKLKQAAETE
KAKLERDIANAGDNTALKADLEERLTKVKARLDAYKKIEETVIGWGPIDPNVKDGTQVGF
SSTYGKQRPGYLSLLTLQEENGRVLAAVAQGDVDHAKNVATVVPGIGTTVEGGLQNEIKR
GANLRSAAAAEGNIDTKDVAVVSWLGYEAPPAPSKDLGEDLKIVTMDLAEKGSDKLAGFL
TGVNASRMYGAGDANMTLLGHSYGSVVSGRATTKIADGVVDNEILFGSPGMGTYDPSEIH
VPEGRRFVSGVPKGDWVQGASDDRGAYYLGLGILAPPLIPAVIGAGSAAELYGVGQLGMD
PMNHDSTFIPISSDATGSYAYADGLFDAGSKTVLRNHSVYMDPGTGTLRDMGRIVAGGNP
KP
Download sequence
Identical sequences A0A095Z9L4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]