SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A096KNC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A096KNC0
Domain Number 1 Region: 72-223
Classification Level Classification E-value
Superfamily Multiheme cytochromes 1.52e-16
Family Di-heme elbow motif 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A096KNC0
Sequence length 231
Comment (tr|A0A096KNC0|A0A096KNC0_9ACTN) Uncharacterized protein {ECO:0000313|EMBL:KGI72699.1} KW=Complete proteome OX=742768 OS=Eggerthella lenta 1_1_60AFAA. GN=HMPREF9458_00067 OC=Eggerthellaceae; Eggerthella.
Sequence
MTVQAHAADRRLVVLAVLGVVLALTAAMWTLAGCAPKAETDAPAESGQKAEGSGSGSGSA
ASAMDGQPVNWTMESDCSMCHTSEAESATDAACPQATAHEAEGVACAQCHTDEGELSTAH
ADVKFGDKPASKPTMVTVDPATCESCHGTLEDMAAKTADSTALTDDKGTTVNPHERPAGE
KHEENPATCTDCHNNHSKDLPKDSMRYCAQCHHRGTFECGTCHELRERATT
Download sequence
Identical sequences A0A096KNC0 C8WLI2
gi|257790295|ref|YP_003180901.1| WP_015760028.1.14381 WP_015760028.1.87427 479437.Elen_0527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]